Mouse anti-Human GALNT6 Monoclonal Antibody | anti-GALNT6 antibody

GALNT6 (Polypeptide N-acetylgalactosaminyltransferase 6, Polypeptide GalNAc Transferase 6, pp-GaNTase 6, GalNAcT6, GalNAc-T6, N-acetylgalactosaminyltransferase 6, Protein-UDP acetylgalactosaminyltransferase 6, UDP-GalNAc:polypeptide) (AP)

Cat. Num. AAA6131414

• Gene Names: GALNT6; GalNAcT6; GALNAC-T6
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GALNT6; Monoclonal Antibody; GALNT6 (Polypeptide N-acetylgalactosaminyltransferase 6; Polypeptide GalNAc Transferase 6; pp-GaNTase 6; GalNAcT6; GalNAc-T6; N-acetylgalactosaminyltransferase 6; Protein-UDP acetylgalactosaminyltransferase 6; UDP-GalNAc:polypeptide) (AP); anti-GALNT6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4C10
• Specificity: Recognizes human GALNT6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 5307

• Applicable Applications for anti-GALNT6 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa523-623 from GALNT6 (NP_009141) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV*
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(GALNT6 monoclonal antibody Western Blot analysis of GALNT6 expression in A-431)

Western Blot (WB)

(Western Blot analysis of GALNT6 expression in transfected 293T cell line by GALNT6 monoclonal antibody Lane 1: GALNT6 transfected lysate (71kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GALNT6 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of GALNT6 over-expressed 293 cell line, cotransfected with GALNT6 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GALNT6 monoclonal antibody (GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-GALNT6 antibody

Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. May participate in synthesis of oncofetal fibronectin. Has activity toward Muc1a, Muc2, EA2 and fibronectin peptides.

Product Categories/Family for anti-GALNT6 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 1519312364
• NCBI GeneID: 11226
• NCBI Accession #: NM_007210.4
• NCBI GenBank Nucleotide #: NM_007210
• UniProt Accession #: Q8NCL4
• NCBI Official Full Name: Homo sapiens polypeptide N-acetylgalactosaminyltransferase 6 (GALNT6), mRNA
• NCBI Official Synonym Full Names: polypeptide N-acetylgalactosaminyltransferase 6
• NCBI Official Symbol: GALNT6
• NCBI Official Synonym Symbols: GalNAcT6; GALNAC-T6
• NCBI Protein Information: polypeptide N-acetylgalactosaminyltransferase 6
• UniProt Protein Name: Polypeptide N-acetylgalactosaminyltransferase 6
• Protein Family: Polypeptide N-acetylgalactosaminyltransferase
• UniProt Gene Name: GALNT6
• UniProt Synonym Gene Names: GalNAc-T6; pp-GaNTase 6
• UniProt Entry Name: GALT6_HUMAN

NCBI Description

This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. The encoded protein is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin. [provided by RefSeq, Jul 2008]