Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human GALNT6 Monoclonal Antibody | anti-GALNT6 antibody

GALNT6 (Polypeptide N-acetylgalactosaminyltransferase 6, Polypeptide GalNAc Transferase 6, pp-GaNTase 6, GalNAcT6, GalNAc-T6, N-acetylgalactosaminyltransferase 6, Protein-UDP acetylgalactosaminyltransferase 6, UDP-GalNAc:polypeptide) (PE)

Gene Names
GALNT6; GalNAcT6; GALNAC-T6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GALNT6; Monoclonal Antibody; GALNT6 (Polypeptide N-acetylgalactosaminyltransferase 6; Polypeptide GalNAc Transferase 6; pp-GaNTase 6; GalNAcT6; GalNAc-T6; N-acetylgalactosaminyltransferase 6; Protein-UDP acetylgalactosaminyltransferase 6; UDP-GalNAc:polypeptide) (PE); anti-GALNT6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C10
Specificity
Recognizes human GALNT6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
5307
Applicable Applications for anti-GALNT6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa523-623 from GALNT6 (NP_009141) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(GALNT6 monoclonal antibody Western Blot analysis of GALNT6 expression in A-431)

Western Blot (WB) (GALNT6 monoclonal antibody Western Blot analysis of GALNT6 expression in A-431)

Western Blot (WB)

(Western Blot analysis of GALNT6 expression in transfected 293T cell line by GALNT6 monoclonal antibody Lane 1: GALNT6 transfected lysate (71kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GALNT6 expression in transfected 293T cell line by GALNT6 monoclonal antibody Lane 1: GALNT6 transfected lysate (71kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GALNT6 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GALNT6 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of GALNT6 over-expressed 293 cell line, cotransfected with GALNT6 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GALNT6 monoclonal antibody (GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of GALNT6 over-expressed 293 cell line, cotransfected with GALNT6 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GALNT6 monoclonal antibody (GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-GALNT6 antibody
Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. May participate in synthesis of oncofetal fibronectin. Has activity toward Muc1a, Muc2, EA2 and fibronectin peptides.
Product Categories/Family for anti-GALNT6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens polypeptide N-acetylgalactosaminyltransferase 6 (GALNT6), mRNA
NCBI Official Synonym Full Names
polypeptide N-acetylgalactosaminyltransferase 6
NCBI Official Symbol
GALNT6
NCBI Official Synonym Symbols
GalNAcT6; GALNAC-T6
NCBI Protein Information
polypeptide N-acetylgalactosaminyltransferase 6
UniProt Protein Name
Polypeptide N-acetylgalactosaminyltransferase 6
UniProt Gene Name
GALNT6
UniProt Synonym Gene Names
GalNAc-T6; pp-GaNTase 6
UniProt Entry Name
GALT6_HUMAN

NCBI Description

This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. The encoded protein is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin. [provided by RefSeq, Jul 2008]

Research Articles on GALNT6

Similar Products

Product Notes

The GALNT6 galnt6 (Catalog #AAA6157929) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GALNT6 (Polypeptide N-acetylgalactosaminyltransferase 6, Polypeptide GalNAc Transferase 6, pp-GaNTase 6, GalNAcT6, GalNAc-T6, N-acetylgalactosaminyltransferase 6, Protein-UDP acetylgalactosaminyltransferase 6, UDP-GalNAc:polypeptide) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GALNT6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GALNT6 galnt6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GALNT6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.