Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human FMNL1 Monoclonal Antibody | anti-FMNL1 antibody

FMNL1 (Formin-like Protein 1, CLL-associated Antigen KW-13, Leukocyte Formin, C17orf1, C17orf1B, FMNL) (HRP)

Gene Names
FMNL1; FMNL; FHOD4; KW-13; C17orf1; C17orf1B
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FMNL1; Monoclonal Antibody; FMNL1 (Formin-like Protein 1; CLL-associated Antigen KW-13; Leukocyte Formin; C17orf1; C17orf1B; FMNL) (HRP); anti-FMNL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D7
Specificity
Recognizes human FMNL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-FMNL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa893-991 from human FMNL1 (NP_005883) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged FMNL1 is 0.3ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged FMNL1 is 0.3ng/ml as a capture antibody)
Related Product Information for anti-FMNL1 antibody
May play a role in the control of cell motility and survival of macrophages. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape.
Product Categories/Family for anti-FMNL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
752
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
121 kDa
NCBI Official Full Name
formin-like protein 1
NCBI Official Synonym Full Names
formin-like 1
NCBI Official Symbol
FMNL1
NCBI Official Synonym Symbols
FMNL; FHOD4; KW-13; C17orf1; C17orf1B
NCBI Protein Information
formin-like protein 1; leukocyte formin; CLL-associated antigen KW-13
UniProt Protein Name
Formin-like protein 1
UniProt Gene Name
FMNL1
UniProt Synonym Gene Names
C17orf1; C17orf1B; FMNL
UniProt Entry Name
FMNL_HUMAN

NCBI Description

This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. An alternative splice variant has been described but its full length sequence has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

FMNL1: May play a role in the control of cell motility and survival of macrophages. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape. Belongs to the formin homology family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: membrane; plasma membrane; phagocytic vesicle; cell cortex; cytosol

Molecular Function: actin filament binding; protein binding; Rac GTPase binding; GTPase activating protein binding; profilin binding

Biological Process: substrate-bound cell migration; regulation of cell shape; actin filament severing; cortical actin cytoskeleton organization and biogenesis

Research Articles on FMNL1

Similar Products

Product Notes

The FMNL1 fmnl1 (Catalog #AAA6152544) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FMNL1 (Formin-like Protein 1, CLL-associated Antigen KW-13, Leukocyte Formin, C17orf1, C17orf1B, FMNL) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FMNL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FMNL1 fmnl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FMNL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.