Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FGF8 monoclonal antibody (M06), clone 3H2 Western Blot analysis of FGF8 expression in HepG2.)

Mouse FGF8 Monoclonal Antibody | anti-FGF8 antibody

FGF8 (Fibroblast Growth Factor 8 (androgen-Induced), AIGF, HBGF-8, MGC149376) (APC)

Gene Names
FGF8; HH6; AIGF; KAL6; FGF-8; HBGF-8
Applications
Western Blot
Purity
Purified
Synonyms
FGF8; Monoclonal Antibody; FGF8 (Fibroblast Growth Factor 8 (androgen-Induced); AIGF; HBGF-8; MGC149376) (APC); Fibroblast Growth Factor 8 (androgen-Induced); MGC149376; anti-FGF8 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H2
Specificity
Recognizes FGF8.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FGF8 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FGF8 (NP_149354, 65aa-133aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(FGF8 monoclonal antibody (M06), clone 3H2 Western Blot analysis of FGF8 expression in HepG2.)

Western Blot (WB) (FGF8 monoclonal antibody (M06), clone 3H2 Western Blot analysis of FGF8 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged FGF8 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FGF8 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-FGF8 antibody
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq]
Product Categories/Family for anti-FGF8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
fibroblast growth factor 8 isoform E
NCBI Official Synonym Full Names
fibroblast growth factor 8
NCBI Official Symbol
FGF8
NCBI Official Synonym Symbols
HH6; AIGF; KAL6; FGF-8; HBGF-8
NCBI Protein Information
fibroblast growth factor 8
UniProt Protein Name
Fibroblast growth factor 8
UniProt Gene Name
FGF8
UniProt Synonym Gene Names
AIGF; FGF-8; AIGF; HBGF-8
UniProt Entry Name
FGF8_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF8: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Defects in FGF8 are the cause of Kallmann syndrome type 6 (KAL6). Kallmann syndrome is a disorder that associates hypogonadotropic hypogonadism and anosmia. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin-releasing hormone- synthesizing neurons. In some patients other developmental anomalies can be present, which include renal agenesis, cleft lip and/or palate, selective tooth agenesis, and bimanual synkinesis. In some cases anosmia may be absent or inconspicuous. Defects in FGF8 are a cause of idiopathic hypogonadotropic hypogonadism (IHH). IHH is defined as a deficiency of the pituitary secretion of follicle-stimulating hormone and luteinizing hormone, which results in the impairment of pubertal maturation and of reproductive function. Belongs to the heparin-binding growth factors family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted; Cytokine

Chromosomal Location of Human Ortholog: 10q24

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: growth factor activity; type 2 fibroblast growth factor receptor binding; type 1 fibroblast growth factor receptor binding; chemoattractant activity; fibroblast growth factor receptor binding

Biological Process: nerve growth factor receptor signaling pathway; adrenocorticotropin hormone secreting cell differentiation; gastrulation; motor axon guidance; Wnt receptor signaling pathway through beta-catenin; mesodermal cell migration; response to organic cyclic substance; BMP signaling pathway; positive chemotaxis; induction of an organ; male genitalia development; pallium development; mesonephros development; negative regulation of neuron apoptosis; regulation of odontogenesis of dentine-containing teeth; response to drug; anatomical structure morphogenesis; fibroblast growth factor receptor signaling pathway; positive regulation of mitosis; neural plate morphogenesis; subpallium development; forebrain morphogenesis; dorsal/ventral axon guidance; patterning of blood vessels; forebrain neuron development; midbrain-hindbrain boundary development; response to oxidative stress; metanephros development; gonad development; apoptosis; cell proliferation in forebrain; thyroid stimulating hormone secreting cell differentiation; forebrain dorsal/ventral pattern formation; embryonic hindlimb morphogenesis; odontogenesis; positive regulation of cell proliferation; thyroid gland development; heart looping; otic vesicle formation; epidermal growth factor receptor signaling pathway; negative regulation of cardiac muscle development; pharyngeal system development; phosphoinositide-mediated signaling; MAPKKK cascade; positive regulation of organ growth; ureteric bud branching; insulin receptor signaling pathway; innate immune response; blood vessel remodeling

Disease: Hypogonadotropic Hypogonadism 6 With Or Without Anosmia

Research Articles on FGF8

Similar Products

Product Notes

The FGF8 fgf8 (Catalog #AAA6166854) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FGF8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGF8 fgf8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGF8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.