Mouse FGF8 Monoclonal Antibody | anti-FGF8 antibody

FGF8 (Fibroblast Growth Factor 8 (androgen-Induced), AIGF, HBGF-8, MGC149376) (FITC)

Cat. Num. AAA6176492

• Gene Names: FGF8; HH6; AIGF; KAL6; FGF-8; HBGF-8
• Applications: ELISA
• Purity: Purified
• Synonyms: FGF8; Monoclonal Antibody; FGF8 (Fibroblast Growth Factor 8 (androgen-Induced); AIGF; HBGF-8; MGC149376) (FITC); Fibroblast Growth Factor 8 (androgen-Induced); MGC149376; anti-FGF8 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2A12
• Specificity: Recognizes FGF8.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-FGF8 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: FGF8 (NP_149354, 65aa-133aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FGF8 is approximately 0.3ng/ml as a capture antibody.)

Related Product Information for anti-FGF8 antibody

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq]

Product Categories/Family for anti-FGF8 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 15147348
• NCBI GeneID: 2253
• NCBI Accession #: NP_149354
• NCBI GenBank Nucleotide #: NM_033164
• UniProt Accession #: P55075
• Molecular Weight: 24kDa
• NCBI Official Full Name: fibroblast growth factor 8 isoform E
• NCBI Official Synonym Full Names: fibroblast growth factor 8
• NCBI Official Symbol: FGF8
• NCBI Official Synonym Symbols: HH6; AIGF; KAL6; FGF-8; HBGF-8
• NCBI Protein Information: fibroblast growth factor 8
• UniProt Protein Name: Fibroblast growth factor 8
• UniProt Gene Name: FGF8
• UniProt Synonym Gene Names: AIGF; FGF-8; AIGF; HBGF-8
• UniProt Entry Name: FGF8_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF8: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Defects in FGF8 are the cause of Kallmann syndrome type 6 (KAL6). Kallmann syndrome is a disorder that associates hypogonadotropic hypogonadism and anosmia. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin-releasing hormone- synthesizing neurons. In some patients other developmental anomalies can be present, which include renal agenesis, cleft lip and/or palate, selective tooth agenesis, and bimanual synkinesis. In some cases anosmia may be absent or inconspicuous. Defects in FGF8 are a cause of idiopathic hypogonadotropic hypogonadism (IHH). IHH is defined as a deficiency of the pituitary secretion of follicle-stimulating hormone and luteinizing hormone, which results in the impairment of pubertal maturation and of reproductive function. Belongs to the heparin-binding growth factors family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted; Cytokine

Chromosomal Location of Human Ortholog: 10q24

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: growth factor activity; type 2 fibroblast growth factor receptor binding; type 1 fibroblast growth factor receptor binding; chemoattractant activity; fibroblast growth factor receptor binding

Biological Process: nerve growth factor receptor signaling pathway; adrenocorticotropin hormone secreting cell differentiation; gastrulation; motor axon guidance; Wnt receptor signaling pathway through beta-catenin; mesodermal cell migration; response to organic cyclic substance; BMP signaling pathway; positive chemotaxis; induction of an organ; male genitalia development; pallium development; mesonephros development; negative regulation of neuron apoptosis; regulation of odontogenesis of dentine-containing teeth; response to drug; anatomical structure morphogenesis; fibroblast growth factor receptor signaling pathway; positive regulation of mitosis; neural plate morphogenesis; subpallium development; forebrain morphogenesis; dorsal/ventral axon guidance; patterning of blood vessels; forebrain neuron development; midbrain-hindbrain boundary development; response to oxidative stress; metanephros development; gonad development; apoptosis; cell proliferation in forebrain; thyroid stimulating hormone secreting cell differentiation; forebrain dorsal/ventral pattern formation; embryonic hindlimb morphogenesis; odontogenesis; positive regulation of cell proliferation; thyroid gland development; heart looping; otic vesicle formation; epidermal growth factor receptor signaling pathway; negative regulation of cardiac muscle development; pharyngeal system development; phosphoinositide-mediated signaling; MAPKKK cascade; positive regulation of organ growth; ureteric bud branching; insulin receptor signaling pathway; innate immune response; blood vessel remodeling

Disease: Hypogonadotropic Hypogonadism 6 With Or Without Anosmia