Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AURKB expression in transfected 293T cell line by AURKB monoclonal antibody Lane 1: AURKB transfected lysate (39.3kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human Aurora B Monoclonal Antibody | anti-AURKB antibody

Aurora B (Aurora Kinase B, Serine/Threonine-protein Kinase Aurora-B, Aurora- and IPL1-like Midbody-associated protein 1, Serine/threonine-protein Kinase 12, Aurora/IPL1-related Kinase 2, AIM-1, Aurora-related kinase 2, ARK-2, STK-1, AURKB, AIK2, AIM1, ARK

Gene Names
AURKB; AIK2; AIM1; ARK2; AurB; IPL1; STK5; AIM-1; STK12; PPP1R48; aurkb-sv1; aurkb-sv2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Aurora B; Monoclonal Antibody; Aurora B (Aurora Kinase B; Serine/Threonine-protein Kinase Aurora-B; Aurora- and IPL1-like Midbody-associated protein 1; Serine/threonine-protein Kinase 12; Aurora/IPL1-related Kinase 2; AIM-1; Aurora-related kinase 2; ARK-2; STK-1; AURKB; AIK2; AIM1; ARK; anti-AURKB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6G8
Specificity
Recognizes human AURKB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-AURKB antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from AURKB (AAH09751) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AURKB expression in transfected 293T cell line by AURKB monoclonal antibody Lane 1: AURKB transfected lysate (39.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AURKB expression in transfected 293T cell line by AURKB monoclonal antibody Lane 1: AURKB transfected lysate (39.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Testing Data

(Detection limit for recombinant GST tagged AURKB is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AURKB is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of AURKB over-expressed 293 cell line, cotransfected with AURKB Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AURKB monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of AURKB over-expressed 293 cell line, cotransfected with AURKB Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AURKB monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-AURKB antibody
Chromosomal segregation during mitosis as well as meiosis is regulated by kinases and phosphatases. The Aurora kinases associate with microtubules during chromosome movement and segregation. STK12 (Aurora kinase B) localizes to microtubules near kinetochores, specifically to the specialized microtubules called K-fibers, and Aurora kinase A localizes to centrosomes.
Product Categories/Family for anti-AURKB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
39,467 Da
NCBI Official Full Name
Homo sapiens aurora kinase B, mRNA
NCBI Official Synonym Full Names
aurora kinase B
NCBI Official Symbol
AURKB
NCBI Official Synonym Symbols
AIK2; AIM1; ARK2; AurB; IPL1; STK5; AIM-1; STK12; PPP1R48; aurkb-sv1; aurkb-sv2
NCBI Protein Information
aurora kinase B
Protein Family

NCBI Description

This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregation of chromosomes during mitosis and meiosis through association with microtubules. A pseudogene of this gene is located on chromosome 8. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2015]

Research Articles on AURKB

Similar Products

Product Notes

The AURKB (Catalog #AAA6130153) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Aurora B (Aurora Kinase B, Serine/Threonine-protein Kinase Aurora-B, Aurora- and IPL1-like Midbody-associated protein 1, Serine/threonine-protein Kinase 12, Aurora/IPL1-related Kinase 2, AIM-1, Aurora-related kinase 2, ARK-2, STK-1, AURKB, AIK2, AIM1, ARK reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Aurora B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AURKB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Aurora B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.