Mouse anti-Human FGF5 Monoclonal Antibody | anti-FGF5 antibody

FGF5 (Fibroblast Growth Factor 5, FGF-5, Heparin-binding Growth Factor 5, HBGF-5, Smag-82) APC

Cat. Num. AAA6136591

• Gene Names: FGF5; HBGF-5; TCMGLY; Smag-82
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FGF5; Monoclonal Antibody; FGF5 (Fibroblast Growth Factor 5; FGF-5; Heparin-binding Growth Factor 5; HBGF-5; Smag-82) APC; anti-FGF5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B4
• Specificity: Recognizes human FGF5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-FGF5 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa159-268 from human FGF5 (NP_004455.2) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(FGF5 monoclonal antibody. Western Blot analysis of FGF5 expression in human colon.)

Immunoprecipitation (IP)

(Immunoprecipitation of FGF5 transfected lysate using FGF5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FGF5 rabbit polyclonal antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between FGFR2 and FGF5 HeLa cells were stained with FGFR2 rabbit purified polyclonal 1:1200 and FGF5 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-FGF5 antibody

Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase.

Product Categories/Family for anti-FGF5 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 73486655
• NCBI GeneID: 2250
• NCBI Accession #: NP_004455.2
• NCBI GenBank Nucleotide #: NM_004464
• UniProt Accession #: P12034; O75846; Q3Y8M3; Q8NF90; B2R554
• Molecular Weight: 13,006 Da
• NCBI Official Full Name: fibroblast growth factor 5 isoform 1
• NCBI Official Synonym Full Names: fibroblast growth factor 5
• NCBI Official Symbol: FGF5
• NCBI Official Synonym Symbols: HBGF-5; TCMGLY; Smag-82
• NCBI Protein Information: fibroblast growth factor 5
• UniProt Protein Name: Fibroblast growth factor 5
• Protein Family: Fibroblast growth factor
• UniProt Gene Name: FGF5
• UniProt Synonym Gene Names: FGF-5; HBGF-5

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF5: Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Oncoprotein; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q21.21

Cellular Component: extracellular region; extracellular space

Molecular Function: 1-phosphatidylinositol-3-kinase activity; fibroblast growth factor receptor binding; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; protein-tyrosine kinase activity; Ras guanyl-nucleotide exchange factor activity

Biological Process: cell proliferation; cell-cell signaling; fibroblast growth factor receptor signaling pathway; MAPKKK cascade; nervous system development; phosphoinositide-mediated signaling; positive regulation of cell proliferation; regulation of phosphoinositide 3-kinase cascade

Disease: Trichomegaly