Fibroblast growth factor 5 Recombinant Protein | FGF5 recombinant protein

Recombinant Human Fibroblast growth factor 5 protein

Cat. Num. AAA951065

• Gene Names: FGF5; HBGF-5; TCMGLY; Smag-82
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Fibroblast growth factor 5; Recombinant Human Fibroblast growth factor 5 protein; Heparin-binding growth factor 5; HBGF-5; Smag-82; FGF5 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 18-268aa; Full Length
• Sequence: AWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
• Sequence Length: 123

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for FGF5 recombinant protein

Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase.

Product Categories/Family for FGF5 recombinant protein

Cardiovascular

References

Expression of the murine fibroblast growth factor 5 gene in the adult central nervous system.Haub O., Drucker B., Goldfarb M.Proc. Natl. Acad. Sci. U.S.A. 87:8022-8026(1990) The human FGF-5 oncogene encodes a novel protein related to fibroblast growth factors.Zhan X., Bates B., Hu X., Goldfarb M.Mol. Cell. Biol. 8:3487-3495(1988) An alternatively-spliced FGF-5 mRNA is abundant in brain and translates into a partial agonist/antagonist for FGF-5 neurotrophic activity.Ozawa K., Suzuki S., Asada M., Tomooka Y., Li A., Yoneda A., Komi A., Imamura T.Differential display identification of 40 genes with altered expression in activated human smooth muscle cells. Local expression in atherosclerotic lesions of smags, smooth muscle activation-specific genes.de Vries C.J.M., van Achterberg T.A.E., Horrevoets A.J.G., ten Cate J.W., Pannekoek H.J. Biol. Chem. 275:23939-23947(2000) Identification of fibroblast growth factor-5 as an overexpressed antigen in multiple human adenocarcinomas.Hanada K.-I., Perry-Lalley D.M., Ohnmacht G.A., Bettinotti M.P., Yang J.C.Cancer Res. 61:5511-5516(2001) NIEHS SNPs programComplete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 73486655
• NCBI GeneID: 2250
• NCBI Accession #: NP_004455.2
• NCBI GenBank Nucleotide #: NM_004464.3
• UniProt Accession #: P12034; O75846; Q3Y8M3; Q8NF90; B2R554
• Molecular Weight: 54.6 kDa
• NCBI Official Full Name: fibroblast growth factor 5 isoform 1
• NCBI Official Synonym Full Names: fibroblast growth factor 5
• NCBI Official Symbol: FGF5
• NCBI Official Synonym Symbols: HBGF-5; TCMGLY; Smag-82
• NCBI Protein Information: fibroblast growth factor 5
• UniProt Protein Name: Fibroblast growth factor 5
• Protein Family: Fibroblast growth factor
• UniProt Gene Name: FGF5
• UniProt Synonym Gene Names: FGF-5; HBGF-5
• UniProt Entry Name: FGF5_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF5: Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Cytokine; Secreted, signal peptide; Oncoprotein

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular region; extracellular space; intracellular

Molecular Function: fibroblast growth factor receptor binding; growth factor activity

Biological Process: activation of MAPKK activity; axon guidance; cell proliferation; cell-cell signaling; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; glial cell differentiation; innate immune response; insulin receptor signaling pathway; MAPKKK cascade; nerve growth factor receptor signaling pathway; nervous system development; phosphoinositide-mediated signaling; positive regulation of cell division; positive regulation of cell proliferation; Ras protein signal transduction; small GTPase mediated signal transduction; vascular endothelial growth factor receptor signaling pathway

Disease: Trichomegaly