Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human FCN1 Monoclonal Antibody | anti-FCN1 antibody

FCN1 (Ficolin-1, Collagen/Fibrinogen Domain-containing Protein 1, Ficolin-A, Ficolin-alpha, M-ficolin, FCNM) (HRP)

Gene Names
FCN1; FCNM
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FCN1; Monoclonal Antibody; FCN1 (Ficolin-1; Collagen/Fibrinogen Domain-containing Protein 1; Ficolin-A; Ficolin-alpha; M-ficolin; FCNM) (HRP); anti-FCN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B7
Specificity
Recognizes human FCN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-FCN1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-300 form human FCN1 (NP_001994) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESY
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of FCN1 expression in transfected 293T cell line by FCN1 monoclonal antibody. Lane 1: FCN1 transfected lysate (35.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FCN1 expression in transfected 293T cell line by FCN1 monoclonal antibody. Lane 1: FCN1 transfected lysate (35.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged FCN1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FCN1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-FCN1 antibody
Complement-activating lectin and pattern recognition receptor. Binds GlcNAc. Binds preferentially to 9-O-acetylated 2-6-linked sialic acid derivatives and to various glycans containing sialic acid engaged in a 2-3 linkage.
Product Categories/Family for anti-FCN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
ficolin-1
NCBI Official Synonym Full Names
ficolin 1
NCBI Official Symbol
FCN1
NCBI Official Synonym Symbols
FCNM
NCBI Protein Information
ficolin-1
UniProt Protein Name
Ficolin-1
Protein Family
UniProt Gene Name
FCN1
UniProt Synonym Gene Names
FCNM
UniProt Entry Name
FCN1_HUMAN

NCBI Description

The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1 encoded by FCN1 is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity. [provided by RefSeq, Jul 2008]

Uniprot Description

FCN1: Complement-activating lectin and pattern recognition receptor. Binds GlcNAc. Binds preferentially to 9-O-acetylated 2- 6-linked sialic acid derivatives and to various glycans containing sialic acid engaged in a 2-3 linkage. Belongs to the ficolin lectin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 9q34

Cellular Component: collagen; extrinsic to external side of plasma membrane; extracellular region

Molecular Function: protein binding; G-protein-coupled receptor binding; metal ion binding; carbohydrate binding; pattern recognition receptor activity; sialic acid binding

Biological Process: G-protein coupled receptor protein signaling pathway; negative regulation of virion penetration into host cell; cell surface pattern recognition receptor signaling pathway; innate immune response; complement activation, lectin pathway; recognition of apoptotic cell; complement activation

Research Articles on FCN1

Similar Products

Product Notes

The FCN1 fcn1 (Catalog #AAA6152487) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FCN1 (Ficolin-1, Collagen/Fibrinogen Domain-containing Protein 1, Ficolin-A, Ficolin-alpha, M-ficolin, FCNM) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FCN1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FCN1 fcn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FCN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.