Western Blot (WB)
(Western Blot analysis of DSTYK expression in transfected 293T cell line by DSTYK monoclonal antibody (M06), clone 1F9.Lane 1: DSTYK transfected lysate (Predicted MW: 66.4 KDa).Lane 2: Non-transfected lysate.)
Mouse DSTYK Monoclonal Antibody | anti-DSTYK antibody
DSTYK (Dual Serine/Threonine and Tyrosine Protein Kinase, DustyPK, HDCMD38P, KIAA0472, RIP5, RIPK5) (FITC)
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
DSTYK; Monoclonal Antibody; DSTYK (Dual Serine/Threonine and Tyrosine Protein Kinase; DustyPK; HDCMD38P; KIAA0472; RIP5; RIPK5) (FITC); Dual Serine/Threonine and Tyrosine Protein Kinase; RIPK5; anti-DSTYK antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F9
Specificity
Recognizes DSTYK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
929
Applicable Applications for anti-DSTYK antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DSTYK (NP_056190, 80aa-189aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQDCNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAHQGNWETIPE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of DSTYK expression in transfected 293T cell line by DSTYK monoclonal antibody (M06), clone 1F9.Lane 1: DSTYK transfected lysate (Predicted MW: 66.4 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of DSTYK expression in transfected 293T cell line by DSTYK monoclonal antibody (M06), clone 1F9.Lane 1: DSTYK transfected lysate (Predicted MW: 66.4 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-DSTYK antibody
This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. It is thought to function as a regulator of cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-DSTYK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
dual serine/threonine and tyrosine protein kinase isoform 1
UniProt Protein Name
Dual serine/threonine and tyrosine protein kinase
Protein Family
UniProt Gene Name
DSTYK
UniProt Synonym Gene Names
KIAA0472; RIP5; RIPK5; SGK496; Dusty PK; SgK496
UniProt Entry Name
DUSTY_HUMAN
Similar Products
Product Notes
The DSTYK dstyk (Catalog #AAA6176087) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DSTYK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DSTYK dstyk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DSTYK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
