Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TOR1BSample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TOR1B Polyclonal Antibody | anti-TOR1B antibody

TOR1B Antibody - middle region

Gene Names
TOR1B; DQ1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TOR1B; Polyclonal Antibody; TOR1B Antibody - middle region; anti-TOR1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AECCREERPLNASALKLDLEEKLFGQHLATEVIFKALTGFRNNKNPKKPL
Sequence Length
1014
Applicable Applications for anti-TOR1B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TOR1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TOR1BSample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TOR1BSample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-TOR1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
torsin-1B isoform 1
NCBI Official Synonym Full Names
torsin family 1 member B
NCBI Official Symbol
TOR1B
NCBI Official Synonym Symbols
DQ1
NCBI Protein Information
torsin-1B
UniProt Protein Name
Torsin-1B
Protein Family
UniProt Gene Name
TOR1B
UniProt Synonym Gene Names
DQ1

NCBI Description

The protein encoded by this gene is an ATPase found primarily in the endoplasmic reticulum and nuclear envelope. This gene has a highly-similar neighboring gene, TOR1A, that encodes a protein that is likely to interact in a complex with this protein. Finally, this protein may act as a chaperone and play a role in maintaining the integrity of the nuclear envelope and endoplasmic reticulum. Several transcript variants, some protein-coding and others non-protein coding, have been found for this gene. [provided by RefSeq, Dec 2015]

Uniprot Description

May serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins. Plays a role in non-neural cells nuclear envelope and endoplasmic reticulum integrity. May have a redundant function with TOR1A in non-neural tissues.

Research Articles on TOR1B

Similar Products

Product Notes

The TOR1B tor1b (Catalog #AAA3220637) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOR1B Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TOR1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TOR1B tor1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AECCREERPL NASALKLDLE EKLFGQHLAT EVIFKALTGF RNNKNPKKPL. It is sometimes possible for the material contained within the vial of "TOR1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.