Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human FADS3 Monoclonal Antibody | anti-FADS3 antibody

FADS3 (Fatty Acid Desaturase 3, Cytochrome b5-related Protein, CYB5RP)

Gene Names
FADS3; CYB5RP; LLCDL3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FADS3; Monoclonal Antibody; FADS3 (Fatty Acid Desaturase 3; Cytochrome b5-related Protein; CYB5RP); Anti -FADS3 (Fatty Acid Desaturase 3; anti-FADS3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D2
Specificity
Recognizes human FADS3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
PGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVE
Applicable Applications for anti-FADS3 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa16-113 from human FADS3 (NP_068373) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(FADS3 monoclonal antibody. Western Blot analysis of FADS3 expression in human placenta.)

Western Blot (WB) (FADS3 monoclonal antibody. Western Blot analysis of FADS3 expression in human placenta.)

Testing Data

(Detection limit for recombinant GST tagged FADS3 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FADS3 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-FADS3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,145 Da
NCBI Official Full Name
fatty acid desaturase 3
NCBI Official Synonym Full Names
fatty acid desaturase 3
NCBI Official Symbol
FADS3
NCBI Official Synonym Symbols
CYB5RP; LLCDL3
NCBI Protein Information
fatty acid desaturase 3; delta-9-desaturase; cytochrome b5-related protein; delta-9 fatty acid desaturase; linoleoyl-CoA desaturase (delta-9-desaturase)-like 3
UniProt Protein Name
Fatty acid desaturase 3
Protein Family
UniProt Gene Name
FADS3
UniProt Synonym Gene Names
CYB5RP
UniProt Entry Name
FADS3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq, Jul 2008]

Uniprot Description

FADS3: is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, multi-pass; Membrane protein, integral; EC 1.14.19.-; Oxidoreductase

Chromosomal Location of Human Ortholog: 11q12-q13.1

Cellular Component: endoplasmic reticulum membrane; membrane; integral to membrane

Molecular Function: iron ion binding; heme binding; oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water

Biological Process: unsaturated fatty acid biosynthetic process

Research Articles on FADS3

Similar Products

Product Notes

The FADS3 fads3 (Catalog #AAA6003858) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FADS3 (Fatty Acid Desaturase 3, Cytochrome b5-related Protein, CYB5RP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FADS3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the FADS3 fads3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PGAPLPTFCW EQIRAHDQPG DKWLVIERRV YDISRWAQRH PGGSRLIGHH GAEDATDAFR AFHQDLNFVR KFLQPLLIGE LAPEEPSQDG PLNAQLVE. It is sometimes possible for the material contained within the vial of "FADS3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.