Western Blot (WB)
(Western blot analysis of extracts of 293T cells, using ATG9A antibody.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Rabbit ATG9A Polyclonal Antibody | anti-ATG9A antibody
ATG9A Polyclonal Antibody
Gene Names
ATG9A; mATG9; APG9L1; MGD3208
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purification
Synonyms
ATG9A; Polyclonal Antibody; ATG9A Polyclonal Antibody; APG9L1; mATG9; MGD3208; anti-ATG9A antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
WQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRI
Sequence Length
839
Applicable Applications for anti-ATG9A antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:1000 - 1:2000
IF: 1:50 - 1:200
IF: 1:50 - 1:200
Immunogen
A synthetic peptide of human ATG9A
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasmic vesicle, Endoplasmic reticulum membrane, Golgi apparatus, Late endosome membrane, Multi-pass membrane protein, autophagosome membrane, trans-Golgi network membrane
Positive Samples
293T
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of 293T cells, using ATG9A antibody.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Western Blot (WB)
(Western blot analysis of extracts of 293T cells, using ATG9A antibody.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Product Categories/Family for anti-ATG9A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 60kDa; 87kDa; 94kDa
Observed: 50kDa
Observed: 50kDa
NCBI Official Full Name
autophagy-related protein 9A
NCBI Official Synonym Full Names
autophagy related 9A
NCBI Official Symbol
ATG9A
NCBI Official Synonym Symbols
mATG9; APG9L1; MGD3208
NCBI Protein Information
autophagy-related protein 9A
UniProt Protein Name
Autophagy-related protein 9A
Protein Family
UniProt Gene Name
ATG9A
UniProt Synonym Gene Names
APG9L1
Uniprot Description
Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS), the nucleating site for formation of the sequestering vesicle. Cycles between a juxta-nuclear trans-Golgi network compartment and late endosomes. Nutrient starvation induces accumulation on autophagosomes. Starvation-dependent trafficking requires ULK1, ATG13 and SUPT20H.
Research Articles on ATG9A
Similar Products
Product Notes
The ATG9A atg9a (Catalog #AAA9135595) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATG9A Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATG9A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:1000 - 1:2000 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the ATG9A atg9a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WQEVQARIVQ TQKEHQICIH KRELTELDIY HRILRFQNYM VALVNKSLLP LRFRLPGLGE AVFFTRGLKY NFELILFWGP GSLFLNEWSL KAEYKRGGQR LELAQRLSNR I. It is sometimes possible for the material contained within the vial of "ATG9A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
