Mouse anti-Human EXOSC3 Monoclonal Antibody | anti-EXOSC3 antibody

EXOSC3 (Exosome Complex Exonuclease RRP40, Ribosomal RNA-processing Protein 40, Exosome Component 3, p10, RRP40, CGI-102, MGC15120, MGC723, RP11-3J10.8, Rrp40p, bA3J10.7, hRrp40p, p10) (FITC)

Cat. Num. AAA6147106

• Gene Names: EXOSC3; p10; PCH1B; RRP40; Rrp40p; CGI-102; hRrp-40; bA3J10.7
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EXOSC3; Monoclonal Antibody; EXOSC3 (Exosome Complex Exonuclease RRP40; Ribosomal RNA-processing Protein 40; Exosome Component 3; p10; RRP40; CGI-102; MGC15120; MGC723; RP11-3J10.8; Rrp40p; bA3J10.7; hRrp40p; p10) (FITC); anti-EXOSC3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5C3
• Specificity: Recognizes human EXOSC3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-EXOSC3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-276 from human EXOSC3 (AAH02437) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (56.36kD).)

Western Blot (WB)

(Western Blot analysis of EXOSC3 expression in transfected 293T cell line by EXOSC3 monoclonal antibody. Lane 1: EXOSC3 transfected lysate (29.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EXOSC3 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of EXOSC3 transfected lysate using EXOSC3 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with EXOSC3 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged EXOSC3 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(EXOSC3 monoclonal antibody, Western Blot analysis of EXOSC3 expression in Hela NE.)

Product Categories/Family for anti-EXOSC3 antibody

Antibodies; Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 37515281
• NCBI GeneID: 51010
• Molecular Weight: 17,248 Da
• NCBI Official Full Name: Homo sapiens exosome component 3, mRNA
• NCBI Official Synonym Full Names: exosome component 3
• NCBI Official Symbol: EXOSC3
• NCBI Official Synonym Symbols: p10; PCH1B; RRP40; Rrp40p; CGI-102; hRrp-40; bA3J10.7
• NCBI Protein Information: exosome complex component RRP40
• Protein Family: Exosome complex component

NCBI Description

This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012]