Mouse anti-Human EWSR1 Monoclonal Antibody | anti-EWSR1 antibody

EWSR1 (Ewing Sarcoma Breakpoint Region 1 Protein, EWS Oncogene, RNA-binding Protein EWS, EWS, bK984G1.4, CAGF29) (Biotin)

Cat. Num. AAA6141796

• Gene Names: EWSR1; EWS; EWS-FLI1; bK984G1.4
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EWSR1; Monoclonal Antibody; EWSR1 (Ewing Sarcoma Breakpoint Region 1 Protein; EWS Oncogene; RNA-binding Protein EWS; EWS; bK984G1.4; CAGF29) (Biotin); anti-EWSR1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5C10
• Specificity: Recognizes human EWSR1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-EWSR1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa358-453 from human EWSR1 (NP_005234) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB)

(Western Blot analysis of EWSR1 expression in transfected 293T cell line by EWSR1 monoclonal antibody. Lane 1: EWSR1 transfected lysate (68.5kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EWSR1 on formalin-fixed paraffin-embedded human urinary bladder. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged EWSR1 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-EWSR1 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 253970502
• NCBI GeneID: 2130
• NCBI Accession #: NP_005234
• NCBI GenBank Nucleotide #: NM_005243
• UniProt Accession #: Q01844
• Molecular Weight: 68kDa
• NCBI Official Full Name: RNA-binding protein EWS isoform 3
• NCBI Official Synonym Full Names: EWS RNA binding protein 1
• NCBI Official Symbol: EWSR1
• NCBI Official Synonym Symbols: EWS; EWS-FLI1; bK984G1.4
• NCBI Protein Information: RNA-binding protein EWS
• UniProt Protein Name: RNA-binding protein EWS
• Protein Family: RNA-binding protein
• UniProt Gene Name: EWSR1
• UniProt Synonym Gene Names: EWS
• UniProt Entry Name: EWS_HUMAN

NCBI Description

This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. [provided by RefSeq, Jul 2009]

Uniprot Description

EWS: an oncogenic RNA-binding protein. Might normally function as a repressor. Binds RPB3, SF1, calmodulin and RNA. Interacts with and regulated by Pyk2. Relocates from cytoplasm to ribosomes upon Pyk2 activation. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. 5 alternatively-spliced isoforms have been described.

Protein type: Oncoprotein; Transcription, coactivator/corepressor; RNA-binding

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; nucleolus; nucleus

Molecular Function: calmodulin binding; identical protein binding; protein binding; zinc ion binding; RNA binding; nucleotide binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Disease: Ewing Sarcoma