Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ST3GAL5 is 3 ng/ml as a capture antibody.)

Mouse ST3GAL5 Monoclonal Antibody | anti-ST3GAL5 antibody

ST3GAL5 (ST3 beta-Galactoside alpha-2,3-sialyltransferase 5, SIAT9, SIATGM3S, ST3GalV) (FITC)

Gene Names
ST3GAL5; SATI; SIAT9; SPDRS; ST3GalV; SIATGM3S; ST3Gal V
Applications
Western Blot
Purity
Purified
Synonyms
ST3GAL5; Monoclonal Antibody; ST3GAL5 (ST3 beta-Galactoside alpha-2; 3-sialyltransferase 5; SIAT9; SIATGM3S; ST3GalV) (FITC); ST3 beta-Galactoside alpha-2; ST3GalV; anti-ST3GAL5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8B4
Specificity
Recognizes ST3GAL5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ST3GAL5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ST3GAL5 (NP_003887, 31aa-117aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQT
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ST3GAL5 is 3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ST3GAL5 is 3 ng/ml as a capture antibody.)
Related Product Information for anti-ST3GAL5 antibody
Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in this gene has been associated with Amish infantile epilepsy syndrome. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-ST3GAL5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41.0 kDa (359aa)
NCBI Official Full Name
lactosylceramide alpha-2,3-sialyltransferase isoform 1
NCBI Official Synonym Full Names
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
NCBI Official Symbol
ST3GAL5
NCBI Official Synonym Symbols
SATI; SIAT9; SPDRS; ST3GalV; SIATGM3S; ST3Gal V
NCBI Protein Information
lactosylceramide alpha-2,3-sialyltransferase
UniProt Protein Name
Lactosylceramide alpha-2,3-sialyltransferase
UniProt Gene Name
ST3GAL5
UniProt Synonym Gene Names
SIAT9; ST3GalV
UniProt Entry Name
SIAT9_HUMAN

NCBI Description

Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in this gene has been associated with Amish infantile epilepsy syndrome. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ST3GAL5: Catalyzes the formation of ganglioside GM3 (alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1, 4-beta-D- glucosylceramide). Defects in ST3GAL5 are the cause of Amish infantile epilepsy syndrome (AIES). AIES is an autosomal recessive, infantile-onset symptomatic epilepsy associated with developmental stagnation and blindness. Belongs to the glycosyltransferase 29 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Glycan Metabolism - glycosphingolipid biosynthesis - ganglio series; EC 2.4.99.9; Transferase

Chromosomal Location of Human Ortholog: 2p11.2

Cellular Component: Golgi membrane; integral to plasma membrane; integral to membrane; integral to Golgi membrane

Molecular Function: lactosylceramide alpha-2,3-sialyltransferase activity; neolactotetraosylceramide alpha-2,3-sialyltransferase activity; sialyltransferase activity

Biological Process: cellular protein metabolic process; glycosphingolipid biosynthetic process; dolichol-linked oligosaccharide biosynthetic process; carbohydrate metabolic process; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification; ganglioside biosynthetic process

Disease: Amish Infantile Epilepsy Syndrome

Research Articles on ST3GAL5

Similar Products

Product Notes

The ST3GAL5 st3gal5 (Catalog #AAA6179053) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ST3GAL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ST3GAL5 st3gal5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ST3GAL5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.