Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Mouse anti-Human EWSR1 Monoclonal Antibody | anti-EWSR1 antibody

EWSR1 (Ewing Sarcoma Breakpoint Region 1 Protein, EWS Oncogene, RNA-binding Protein EWS, EWS, bK984G1.4, CAGF29) (HRP)

Gene Names
EWSR1; EWS; EWS-FLI1; bK984G1.4
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EWSR1; Monoclonal Antibody; EWSR1 (Ewing Sarcoma Breakpoint Region 1 Protein; EWS Oncogene; RNA-binding Protein EWS; EWS; bK984G1.4; CAGF29) (HRP); anti-EWSR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5C10
Specificity
Recognizes human EWSR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-EWSR1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa358-453 from human EWSR1 (NP_005234) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB)

(Western Blot analysis of EWSR1 expression in transfected 293T cell line by EWSR1 monoclonal antibody. Lane 1: EWSR1 transfected lysate (68.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EWSR1 expression in transfected 293T cell line by EWSR1 monoclonal antibody. Lane 1: EWSR1 transfected lysate (68.5kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EWSR1 on formalin-fixed paraffin-embedded human urinary bladder. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to EWSR1 on formalin-fixed paraffin-embedded human urinary bladder. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged EWSR1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EWSR1 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-EWSR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
RNA-binding protein EWS isoform 3
NCBI Official Synonym Full Names
EWS RNA binding protein 1
NCBI Official Symbol
EWSR1
NCBI Official Synonym Symbols
EWS; EWS-FLI1; bK984G1.4
NCBI Protein Information
RNA-binding protein EWS
UniProt Protein Name
RNA-binding protein EWS
Protein Family
UniProt Gene Name
EWSR1
UniProt Synonym Gene Names
EWS
UniProt Entry Name
EWS_HUMAN

NCBI Description

This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. [provided by RefSeq, Jul 2009]

Uniprot Description

EWS: an oncogenic RNA-binding protein. Might normally function as a repressor. Binds RPB3, SF1, calmodulin and RNA. Interacts with and regulated by Pyk2. Relocates from cytoplasm to ribosomes upon Pyk2 activation. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. 5 alternatively-spliced isoforms have been described.

Protein type: Oncoprotein; Transcription, coactivator/corepressor; RNA-binding

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; nucleolus; nucleus

Molecular Function: calmodulin binding; identical protein binding; protein binding; zinc ion binding; RNA binding; nucleotide binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Disease: Ewing Sarcoma

Research Articles on EWSR1

Similar Products

Product Notes

The EWSR1 ewsr1 (Catalog #AAA6152402) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EWSR1 (Ewing Sarcoma Breakpoint Region 1 Protein, EWS Oncogene, RNA-binding Protein EWS, EWS, bK984G1.4, CAGF29) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EWSR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EWSR1 ewsr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EWSR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.