Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EPOR monoclonal antibody (M02), clone 3F6. Western Blot analysis of EPOR expression in HeLa.)

Mouse EPOR Monoclonal Antibody | anti-EPOR antibody

EPOR (Erythropoietin Receptor, MGC138358) (AP)

Gene Names
EPOR; EPO-R
Applications
Western Blot
Purity
Purified
Synonyms
EPOR; Monoclonal Antibody; EPOR (Erythropoietin Receptor; MGC138358) (AP); Erythropoietin Receptor; MGC138358; anti-EPOR antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F6
Specificity
Recognizes EPOR.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EPOR antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EPOR (NP_000112, 31aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(EPOR monoclonal antibody (M02), clone 3F6. Western Blot analysis of EPOR expression in HeLa.)

Western Blot (WB) (EPOR monoclonal antibody (M02), clone 3F6. Western Blot analysis of EPOR expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged EPOR is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EPOR is approximately 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of EPOR expression in transfected 293T cell line by EPOR monoclonal antibody (M02), clone 3F6.Lane 1: EPOR transfected lysate (Predicted MW: 55.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EPOR expression in transfected 293T cell line by EPOR monoclonal antibody (M02), clone 3F6.Lane 1: EPOR transfected lysate (Predicted MW: 55.1 KDa).Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-EPOR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25.6kDa (232aa) 28-40kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
erythropoietin receptor
NCBI Official Synonym Full Names
erythropoietin receptor
NCBI Official Symbol
EPOR
NCBI Official Synonym Symbols
EPO-R
NCBI Protein Information
erythropoietin receptor
UniProt Protein Name
Erythropoietin receptor
Protein Family
UniProt Gene Name
EPOR
UniProt Synonym Gene Names
EPO-R
UniProt Entry Name
EPOR_HUMAN

NCBI Description

This gene encodes the erythropoietin receptor which is a member of the cytokine receptor family. Upon erythropoietin binding, this receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. Dysregulation of this gene may affect the growth of certain tumors. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

EPOR: erythropoietin receptor: a member of the cytokine receptor family. Mediates erythropoietin-induced erythroblast proliferation, differentiation and survival. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. Forms homodimers on EPO stimulation. Tyrosine-phosphorylated EpoR may bind several SH2 domain-containing proteins including LYN, the adapter protein APS, SHP-1, SHP-2, JAK2, PI3 kinases, STAT5A/B, SOCS3, and CRKL. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. Three alternatively-spliced isoforms have been described. Isoform EPOR-T, missing the cytoplasmic tail, acts as a dominant-negative receptor of EPOR-mediated signaling.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 19p13.3-p13.2

Cellular Component: integral to plasma membrane; extracellular region

Molecular Function: identical protein binding; protein binding; erythropoietin receptor activity

Biological Process: heart development; brain development; decidualization; signal transduction

Disease: Erythrocytosis, Familial, 1

Research Articles on EPOR

Similar Products

Product Notes

The EPOR epor (Catalog #AAA6164135) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EPOR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EPOR epor for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPOR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.