Mouse ENC1 Monoclonal Antibody | anti-ENC1 antibody

ENC1 (Ectodermal-Neural cortex (with BTB-like Domain), CCL28, ENC-1, FLJ39259, KLHL35, KLHL37, NRPB, PIG10, TP53I10) (AP)

Cat. Num. AAA6163900

• Gene Names: ENC1; NRPB; CCL28; ENC-1; PIG10; KLHL35; KLHL37; TP53I10
• Applications: Western Blot
• Purity: Purified
• Synonyms: ENC1; Monoclonal Antibody; ENC1 (Ectodermal-Neural cortex (with BTB-like Domain); CCL28; ENC-1; FLJ39259; KLHL35; KLHL37; NRPB; PIG10; TP53I10) (AP); Ectodermal-Neural cortex (with BTB-like Domain); TP53I10; anti-ENC1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C10
• Specificity: Recognizes ENC1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-ENC1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ENC1 (NP_003624, 17aa-98aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ENC1 monoclonal antibody (M03), clone 3C10. Western Blot analysis of ENC1 expression in IMR-32.)

Related Product Information for anti-ENC1 antibody

DNA damage and/or hyperproliferative signals activate wildtype p53 tumor suppressor protein (TP53; MIM 191170), inducing cell cycle arrest or apoptosis. Mutations that inactivate p53 occur in 50% of all tumors. Polyak et al. (1997) [PubMed 9305847] used serial analysis of gene expression (SAGE) to evaluate cellular mRNA levels in a colorectal cancer cell line transfected with p53. Of 7,202 transcripts identified, only 14 were expressed at levels more than 10-fold higher in p53-expressing cells than in control cells. Polyak et al. (1997) [PubMed 9305847] termed these genes 'p53-induced genes,' or PIGs, several of which were predicted to encode redox-controlling proteins. They noted that reactive oxygen species (ROS) are potent inducers of apoptosis. Flow cytometric analysis showed that p53 expression induces ROS production, which increases as apoptosis progresses under some conditions. The authors stated that the PIG10 gene, also called ENC1, encodes an actin-binding protein. [supplied by OMIM]

Product Categories/Family for anti-ENC1 antibody

Antibodies; Kelch-like Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4505461
• NCBI GeneID: 8507
• NCBI Accession #: NP_003624
• NCBI GenBank Nucleotide #: NM_003633
• UniProt Accession #: O14682
• Molecular Weight: 66kDa
• NCBI Official Full Name: ectoderm-neural cortex protein 1 isoform 1
• NCBI Official Synonym Full Names: ectodermal-neural cortex 1
• NCBI Official Symbol: ENC1
• NCBI Official Synonym Symbols: NRPB; CCL28; ENC-1; PIG10; KLHL35; KLHL37; TP53I10
• NCBI Protein Information: ectoderm-neural cortex protein 1
• UniProt Protein Name: Ectoderm-neural cortex protein 1
• Protein Family: Ectoderm-neural cortex protein
• UniProt Gene Name: ENC1
• UniProt Synonym Gene Names: KLHL37; NRPB; PIG10; ENC-1
• UniProt Entry Name: ENC1_HUMAN

NCBI Description

This gene encodes a member of the kelch-related family of actin-binding proteins. The encoded protein plays a role in the oxidative stress response as a regulator of the transcription factor Nrf2, and expression of this gene may play a role in malignant transformation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

ENC1: Actin-binding protein involved in the regulation of neuronal process formation and in differentiation of neural crest cells. May be down-regulated in neuroblastoma tumors. Substrate- specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Protein type: Actin-binding

Chromosomal Location of Human Ortholog: 5q13

Cellular Component: nucleoplasm; cytoskeleton; nuclear matrix; cell soma; nuclear chromatin; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; actin binding

Biological Process: nervous system development; negative regulation of translation; multicellular organismal development; proteasomal ubiquitin-independent protein catabolic process; protein ubiquitination