Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ATP6V0B expression in transfected 293T cell line by ATP6V0B polyclonal antibody. Lane 1: ATP6V0B transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human ATP6V0B Polyclonal Antibody | anti-ATP6V0B antibody

ATP6V0B (V-type Proton ATPase 21kD Proteolipid Subunit, V-ATPase 21kD Proteolipid Subunit, Vacuolar Proton Pump 21kD Proteolipid Subunit, hATPL, ATP6F) (FITC)

Gene Names
ATP6V0B; ATP6F; HATPL; VMA16
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP6V0B; Polyclonal Antibody; ATP6V0B (V-type Proton ATPase 21kD Proteolipid Subunit; V-ATPase 21kD Proteolipid Subunit; Vacuolar Proton Pump 21kD Proteolipid Subunit; hATPL; ATP6F) (FITC); anti-ATP6V0B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ATP6V0B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
205
Applicable Applications for anti-ATP6V0B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ATP6V0B, aa1-205 (NP_004038.1).
Immunogen Sequence
MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ATP6V0B expression in transfected 293T cell line by ATP6V0B polyclonal antibody. Lane 1: ATP6V0B transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ATP6V0B expression in transfected 293T cell line by ATP6V0B polyclonal antibody. Lane 1: ATP6V0B transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ATP6V0B antibody
Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Product Categories/Family for anti-ATP6V0B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
533
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
V-type proton ATPase 21 kDa proteolipid subunit isoform 1
NCBI Official Synonym Full Names
ATPase H+ transporting V0 subunit b
NCBI Official Symbol
ATP6V0B
NCBI Official Synonym Symbols
ATP6F; HATPL; VMA16
NCBI Protein Information
V-type proton ATPase 21 kDa proteolipid subunit
UniProt Protein Name
V-type proton ATPase 21 kDa proteolipid subunit
Protein Family
UniProt Gene Name
ATP6V0B
UniProt Synonym Gene Names
ATP6F; V-ATPase 21 kDa proteolipid subunit
UniProt Entry Name
VATO_HUMAN

NCBI Description

This gene encodes a portion of the V0 domain of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. Activity of this enzyme is necessary for such varied processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]

Uniprot Description

ATP6V0B: Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Belongs to the V-ATPase proteolipid subunit family.

Protein type: Membrane protein, integral; Transporter, ion channel; Transporter; Transporter, iron; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1p32.3

Cellular Component: phagocytic vesicle membrane; vacuolar membrane; integral to membrane; endosome membrane

Molecular Function: transporter activity; hydrogen ion transmembrane transporter activity

Biological Process: interaction with host; proton transport; cellular iron ion homeostasis; ATP hydrolysis coupled proton transport; insulin receptor signaling pathway; transferrin transport; transmembrane transport

Research Articles on ATP6V0B

Similar Products

Product Notes

The ATP6V0B atp6v0b (Catalog #AAA6370730) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP6V0B (V-type Proton ATPase 21kD Proteolipid Subunit, V-ATPase 21kD Proteolipid Subunit, Vacuolar Proton Pump 21kD Proteolipid Subunit, hATPL, ATP6F) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6V0B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP6V0B atp6v0b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP6V0B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.