Mouse anti-Human, Rat Elongin B Monoclonal Antibody | anti-EloB antibody

Elongin B (Transcription Elongation Factor B Polypeptide 2, TCEB2, RNA Polymerase II Transcription Factor SIII Subunit B, SIII p18, EloB, Elongin 18kD Subunit) (Biotin)

Cat. Num. AAA6141717

• Gene Names: ELOB; SIII; TCEB2
• Reactivity: Human, Rat
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Elongin B; Monoclonal Antibody; Elongin B (Transcription Elongation Factor B Polypeptide 2; TCEB2; RNA Polymerase II Transcription Factor SIII Subunit B; SIII p18; EloB; Elongin 18kD Subunit) (Biotin); anti-EloB antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6F6
• Specificity: Recognizes human TCEB2. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-EloB antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa9-119 from human TCEB2 (NP_009039) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TCEB2 monoclonal antibody. Western Blot analysis of TCEB2 expression in PC-12.)

Western Blot (WB)

(TCEB2 monoclonal antibody, Western Blot analysis of TCEB2 expression in Hela NE.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TCEB2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TCEB2 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-EloB antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 6005890
• NCBI GeneID: 6923
• NCBI Accession #: NP_009039
• NCBI GenBank Nucleotide #: NM_007108
• UniProt Accession #: Q15370; B7WPD3
• Molecular Weight: 13.1 kDa (118 aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: elongin-B isoform a
• NCBI Official Synonym Full Names: elongin B
• NCBI Official Symbol: ELOB
• NCBI Official Synonym Symbols: SIII; TCEB2
• NCBI Protein Information: elongin-B
• UniProt Protein Name: Elongin-B
• UniProt Gene Name: ELOB
• UniProt Synonym Gene Names: EloB

NCBI Description

This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq, Aug 2008]

Uniprot Description

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed:7638163). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells ().