Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CLYBL polyclonal antibody. Western Blot analysis of CLYBL expression in human liver.)

Mouse anti-Human CLYBL Polyclonal Antibody | anti-Clybl antibody

CLYBL (Citrate Lyase Subunit beta-like Protein, Mitochondrial, Citrate Lyase beta-like, CLB, BA134O15.1)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CLYBL; Polyclonal Antibody; CLYBL (Citrate Lyase Subunit beta-like Protein; Mitochondrial; Citrate Lyase beta-like; CLB; BA134O15.1); Anti -CLYBL (Citrate Lyase Subunit beta-like Protein; anti-Clybl antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CLYBL.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK
Applicable Applications for anti-Clybl antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CLYBL, aa1-340 (AAH34360.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CLYBL polyclonal antibody. Western Blot analysis of CLYBL expression in human liver.)

Western Blot (WB) (CLYBL polyclonal antibody. Western Blot analysis of CLYBL expression in human liver.)

Western Blot (WB)

(Western Blot analysis of CLYBL expression in transfected 293T cell line by CLYBL polyclonal antibody. Lane 1: CLYBL transfected lysate (37.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CLYBL expression in transfected 293T cell line by CLYBL polyclonal antibody. Lane 1: CLYBL transfected lysate (37.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-Clybl antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,321 Da
NCBI Official Full Name
citrate lyase subunit beta-like protein, mitochondrial
NCBI Official Synonym Full Names
citrate lyase beta like
NCBI Official Symbol
Clybl
NCBI Protein Information
citrate lyase subunit beta-like protein, mitochondrial; citrate lyase beta-like
UniProt Protein Name
Citrate lyase subunit beta-like protein, mitochondrial
UniProt Gene Name
Clybl
UniProt Synonym Gene Names
Citrate lyase beta-like
UniProt Entry Name
CLYBL_RAT

Uniprot Description

CLYBL: Belongs to the HpcH/HpaI aldolase family. Citrate lyase beta subunit-like subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Lyase; Enzyme, misc.; EC 4.1.-.-

Cellular Component: mitochondrion

Molecular Function: metal ion binding; lyase activity

Biological Process: metabolic process

Similar Products

Product Notes

The Clybl clybl (Catalog #AAA641253) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLYBL (Citrate Lyase Subunit beta-like Protein, Mitochondrial, Citrate Lyase beta-like, CLB, BA134O15.1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLYBL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the Clybl clybl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MALRLLRRAA RGAAAAALLR LKASLAADIP RLGYSSSSHH KYIPRRAVLY VPGNDEKKIK KIPSLNVDCA VLDCEDGVAA NKKNEARLRI VKTLEDIDLG PTEKCVRVNS VSSGLAEEDL ETLLQSRVLP SSLMLPKVES PEEIQWFADK FSFHLKGRKL EQPMNLIPFV ETAMGLLNFK AVCEETLKVG PQVGLFLDAV VFGGEDFRAS IGATSSKETL DILYARQKIV VIAKAFGLQA VDLVYIDFRD GAGLLRQSRE GAAMGFTGKQ VIHPNQIAVV QEQFSPSPEK IKWAEELIAA FKEHQQLGKG AFTFQGSMID MPLLKQAQNT VTLATSIKEK. It is sometimes possible for the material contained within the vial of "CLYBL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.