Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TCEB2 monoclonal antibody. Western Blot analysis of TCEB2 expression in PC-12.)

Mouse anti-Human, Rat Elongin B Monoclonal Antibody | anti-EloB antibody

Elongin B (Transcription Elongation Factor B Polypeptide 2, TCEB2, RNA Polymerase II Transcription Factor SIII Subunit B, SIII p18, EloB, Elongin 18kD Subunit) APC

Gene Names
ELOB; SIII; TCEB2
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Elongin B; Monoclonal Antibody; Elongin B (Transcription Elongation Factor B Polypeptide 2; TCEB2; RNA Polymerase II Transcription Factor SIII Subunit B; SIII p18; EloB; Elongin 18kD Subunit) APC; anti-EloB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6F6
Specificity
Recognizes human TCEB2. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-EloB antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa9-119 from human TCEB2 (NP_009039) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TCEB2 monoclonal antibody. Western Blot analysis of TCEB2 expression in PC-12.)

Western Blot (WB) (TCEB2 monoclonal antibody. Western Blot analysis of TCEB2 expression in PC-12.)

Western Blot (WB)

(TCEB2 monoclonal antibody, Western Blot analysis of TCEB2 expression in Hela NE.)

Western Blot (WB) (TCEB2 monoclonal antibody, Western Blot analysis of TCEB2 expression in Hela NE.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TCEB2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TCEB2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TCEB2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TCEB2 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-EloB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13.1 kDa (118 aa), confirmed by MALDI-TOF.
NCBI Official Full Name
elongin-B isoform a
NCBI Official Synonym Full Names
elongin B
NCBI Official Symbol
ELOB
NCBI Official Synonym Symbols
SIII; TCEB2
NCBI Protein Information
elongin-B
UniProt Protein Name
Elongin-B
UniProt Gene Name
ELOB
UniProt Synonym Gene Names
EloB

NCBI Description

This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq, Aug 2008]

Uniprot Description

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed:7638163). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells ().

Research Articles on EloB

Similar Products

Product Notes

The EloB elob (Catalog #AAA6136414) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Elongin B (Transcription Elongation Factor B Polypeptide 2, TCEB2, RNA Polymerase II Transcription Factor SIII Subunit B, SIII p18, EloB, Elongin 18kD Subunit) APC reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Elongin B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EloB elob for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Elongin B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.