Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence showing EEF1G in HeLa cells using MBS605232 (10ug/ml).)

Mouse eEF1G Monoclonal Antibody | anti-eEF1G antibody

eEF1G (Eukaryotic Translation Elongation Factor 1 gamma, Elongation Factor 1g, eEF-1B gamma, EF1 gamma, EF-1-gamma, EF1G, 2610301D06Rik, GIG35, MGC94929, MGC103354, MGC114210, MGC144723, MGC144724, Translation Elongation Factor eEF-1 gamma Chain) (Azide F

Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
eEF1G; Monoclonal Antibody; eEF1G (Eukaryotic Translation Elongation Factor 1 gamma; Elongation Factor 1g; eEF-1B gamma; EF1 gamma; EF-1-gamma; EF1G; 2610301D06Rik; GIG35; MGC94929; MGC103354; MGC114210; MGC144723; MGC144724; Translation Elongation Factor eEF-1 gamma Chain) (Azide F; Elongation Factor 1 gamma; Pancreatic Tumor-related Protein; PRO1608; anti-eEF1G antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
10C41
Specificity
Recognizes human EEF1G.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-eEF1G antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
WB: 1:500-1:1000
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-437 from human EEF1G (AAH15813) with GST tag. MW of GST tag alone is 26kD.
Immunogen Sequence
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYHVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHDKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIF
Conjugate
MaxLight550
Hybridoma
Sp2/0 myeloma cells with spleen cells from BALB/c mice.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence showing EEF1G in HeLa cells using MBS605232 (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence showing EEF1G in HeLa cells using MBS605232 (10ug/ml).)

Western Blot (WB)

(Western Blot analysis of EEF1G over-expressed 293 cell line, cotransfected with EEF1G Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed withMBS605232. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western Blot analysis of EEF1G over-expressed 293 cell line, cotransfected with EEF1G Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed withMBS605232. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-eEF1G antibody

Similar Products

Product Notes

The eEF1G (Catalog #AAA6209666) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The eEF1G (Eukaryotic Translation Elongation Factor 1 gamma, Elongation Factor 1g, eEF-1B gamma, EF1 gamma, EF-1-gamma, EF1G, 2610301D06Rik, GIG35, MGC94929, MGC103354, MGC114210, MGC144723, MGC144724, Translation Elongation Factor eEF-1 gamma Chain) (Azide F reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's eEF1G can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). WB: 1:500-1:1000 Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the eEF1G for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "eEF1G, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.