Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of EEF1G expression in transfected 293T cell line by EEF1G polyclonal antibody. Lane 1: EEF1G transfected lysate (50.1kD). Lane 2: Non-transfected lysate.)

Rabbit EEF1G Polyclonal Antibody | anti-EEF1G antibody

EEF1G (Elongation Factor 1-gamma, EF-1-gamma, eEF-1B gamma, EF1G, PRO1608) (PE)

Gene Names
EEF1G; EF1G; GIG35
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EEF1G; Polyclonal Antibody; EEF1G (Elongation Factor 1-gamma; EF-1-gamma; eEF-1B gamma; EF1G; PRO1608) (PE); anti-EEF1G antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human EEF1G. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-EEF1G antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human EEF1G, aa1-437 (NP_001395.1).
Immunogen Sequence
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of EEF1G expression in transfected 293T cell line by EEF1G polyclonal antibody. Lane 1: EEF1G transfected lysate (50.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EEF1G expression in transfected 293T cell line by EEF1G polyclonal antibody. Lane 1: EEF1G transfected lysate (50.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-EEF1G antibody
Probably plays a role in anchoring the complex to other cellular components.
Product Categories/Family for anti-EEF1G antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,119 Da
NCBI Official Full Name
elongation factor 1-gamma
NCBI Official Synonym Full Names
eukaryotic translation elongation factor 1 gamma
NCBI Official Symbol
EEF1G
NCBI Official Synonym Symbols
EF1G; GIG35
NCBI Protein Information
elongation factor 1-gamma; PRO1608; EF-1-gamma; eEF-1B gamma; pancreatic tumor-related protein; translation elongation factor eEF-1 gamma chain
UniProt Protein Name
Elongation factor 1-gamma
Protein Family
UniProt Gene Name
EEF1G
UniProt Synonym Gene Names
EF1G; EF-1-gamma
UniProt Entry Name
EF1G_HUMAN

NCBI Description

This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq, Jul 2008]

Uniprot Description

EEF1G: Probably plays a role in anchoring the complex to other cellular components.

Protein type: Translation; Translation elongation

Chromosomal Location of Human Ortholog: 11q12.3

Cellular Component: membrane; endoplasmic reticulum; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; translation elongation factor activity

Biological Process: cellular protein metabolic process; translational elongation; translation; response to virus; gene expression

Research Articles on EEF1G

Similar Products

Product Notes

The EEF1G eef1g (Catalog #AAA6377007) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EEF1G (Elongation Factor 1-gamma, EF-1-gamma, eEF-1B gamma, EF1G, PRO1608) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EEF1G can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EEF1G eef1g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EEF1G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.