Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human EED Monoclonal Antibody | anti-EED antibody

EED (Polycomb Protein EED, hEED, WD Protein Associating with Integrin Cytoplasmic Tails 1, WAIT-1) (HRP)

Gene Names
EED; HEED; WAIT1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EED; Monoclonal Antibody; EED (Polycomb Protein EED; hEED; WD Protein Associating with Integrin Cytoplasmic Tails 1; WAIT-1) (HRP); anti-EED antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B12
Specificity
Recognizes human EED.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-EED antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa342-441 from EED (NP_003788) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged EED is 0.1ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged EED is 0.1ng/ml as a capture antibody)
Related Product Information for anti-EED antibody
Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Also recognizes 'Lys-26' trimethylated histone H1 with the effect of inhibiting PRC2 complex methyltransferase activity on nucleosomal histone H3 'Lys-27', whereas H3 'Lys-27' recognition has the opposite effect, enabling the propagation of this repressive mark. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.
Product Categories/Family for anti-EED antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,524 Da
NCBI Official Full Name
polycomb protein EED isoform a
NCBI Official Synonym Full Names
embryonic ectoderm development
NCBI Official Symbol
EED
NCBI Official Synonym Symbols
HEED; WAIT1
NCBI Protein Information
polycomb protein EED; WD protein associating with integrin cytoplasmic tails 1
UniProt Protein Name
Polycomb protein EED
Protein Family
UniProt Gene Name
EED
UniProt Synonym Gene Names
hEED; WAIT-1
UniProt Entry Name
EED_HUMAN

NCBI Description

This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhancer of zeste 2, the cytoplasmic tail of integrin beta7, immunodeficiency virus type 1 (HIV-1) MA protein, and histone deacetylase proteins. This protein mediates repression of gene activity through histone deacetylation, and may act as a specific regulator of integrin function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

EED: a member of the superfamily of Polycomb group (PcG) methyltransferase proteins with WD-40 repeats. PcG complexes mediate chromatin modifications that contribute to transcriptional silencing during development and carcinogenesis. A part of the Polycomb-repressive complex 2 (PRC2) along with EZH2, SUZ12, RBBP4 and RBBP7 and possibly AEBP2. Interacts with HDAC, HDAC2, histone H1 and YY1. PRC2 trimethylates histone H3 on K9 and K27, transcriptionally repressing target gene including HOXC8, HOXA9, MYT1 and CDKN2A. Appears to be overexpressed in breast and colon cancers. Inhibitors of PRC2-mediated gene repression are being investigated as a cancer therapy. EED and EZH2 are also implicated in the silencing of the inactive X chromosome. Three human isoforms produced by alternative splicing or initiation have been described, and additional isoforms may be produced by alternative initiation.

Protein type: Methyltransferase

Chromosomal Location of Human Ortholog: 11q14.2-q22.3

Cellular Component: nucleoplasm; sex chromatin; pronucleus; ESC/E(Z) complex; cytoplasm; nucleolus; nucleus

Molecular Function: histone methyltransferase activity; identical protein binding; protein binding; chromatin binding

Biological Process: histone methylation; genetic imprinting; transcription, DNA-dependent; negative regulation of gene expression, epigenetic; gene expression; negative regulation of transcription, DNA-dependent; regulation of gene expression, epigenetic

Research Articles on EED

Similar Products

Product Notes

The EED eed (Catalog #AAA6152272) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EED (Polycomb Protein EED, hEED, WD Protein Associating with Integrin Cytoplasmic Tails 1, WAIT-1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EED can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EED eed for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EED, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.