Mouse anti-Human EDAR Monoclonal Antibody | anti-EDAR antibody

EDAR (Tumor Necrosis Factor Receptor Superfamily Member EDAR, Anhidrotic Ectodysplasin Receptor 1, Downless Homolog, EDA-A1 Receptor, Ectodermal Dysplasia Receptor, Ectodysplasin-A Receptor, FLJ94390) APC

Cat. Num. AAA6136354

• Gene Names: EDAR; DL; ED3; ED5; ED1R; EDA3; HRM1; EDA1R; ECTD10A; ECTD10B; EDA-A1R
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EDAR; Monoclonal Antibody; EDAR (Tumor Necrosis Factor Receptor Superfamily Member EDAR; Anhidrotic Ectodysplasin Receptor 1; Downless Homolog; EDA-A1 Receptor; Ectodermal Dysplasia Receptor; Ectodysplasin-A Receptor; FLJ94390) APC; anti-EDAR antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 6C12
• Specificity: Recognizes human EDAR.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-EDAR antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa64-179 from human EDAR (NP_071731) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.76kD).)

Western Blot (WB)

(EDAR monoclonal antibody Western Blot analysis of EDAR expression in human kidney.)

Related Product Information for anti-EDAR antibody

The TNF family ligand ectodysplasin A (EDA) and its receptor EDAR are required for proper development of skin appendages such as hair, teeth and eccrine sweat glands. Loss of function mutations in the Eda gene cause X-linked hypohidrotic ectodermal dysplasia (XLHED), a condition that can be ameliorated in mice and dogs by timely administration of recombinant EDA. The Eda gene on the X chromosome is transcribed as multiple splice variants, only two of which code for the receptor-binding C-terminal TNF homology domain. These two variants code for 391- and 389aa-long proteins called EDA1 and EDA2. EDA1 binds EDAR, whereas EDA2 binds to another receptor, XEDAR. The biology of EDA2 and XEDAR is distinct from that of EDA1. Indeed, XEDAR-deficient mice have no obvious ectodermal dysplasia phenotype, whereas mice deficient in EDA, EDAR, or the signaling adaptor protein EDARADD all display virtually indistinguishable ectodermal dysplasia phenotypes, indicating the predominance of the EDA1-EDAR axis in the development of skin-derived appendages.

Product Categories/Family for anti-EDAR antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 11641231
• NCBI GeneID: 10913
• NCBI Accession #: NP_071731
• NCBI GenBank Nucleotide #: NM_022336
• UniProt Accession #: Q9UNE0; Q52LL5; Q9UND9; B2R9H2; B4DLC5; D3DX74; E9PC98
• Molecular Weight: 51,690 Da
• NCBI Official Full Name: tumor necrosis factor receptor superfamily member EDAR
• NCBI Official Synonym Full Names: ectodysplasin A receptor
• NCBI Official Symbol: EDAR
• NCBI Official Synonym Symbols: DL; ED3; ED5; ED1R; EDA3; HRM1; EDA1R; ECTD10A; ECTD10B; EDA-A1R
• NCBI Protein Information: tumor necrosis factor receptor superfamily member EDAR
• UniProt Protein Name: Tumor necrosis factor receptor superfamily member EDAR
• Protein Family: Tumor necrosis factor receptor superfamily
• UniProt Gene Name: EDAR
• UniProt Synonym Gene Names: DL
• UniProt Entry Name: EDAR_HUMAN

NCBI Description

This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq, Jul 2008]

Uniprot Description

EDAR: Receptor for EDA isoform A1, but not for EDA isoform A2. Mediates the activation of NF-kappa-B and JNK. May promote caspase-independent cell death. Defects in EDAR are a cause of ectodermal dysplasia anhidrotic (EDA); also known ectodermal dysplasia hypohidrotic autosomal recessive (HED). Ectodermal dysplasia defines a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. EDA is characterized by sparse hair (atrichosis or hypotrichosis), abnormal or missing teeth and the inability to sweat due to the absence of sweat glands. Defects in EDAR are the cause of ectodermal dysplasia type 3 (ED3); also known as ectodermal dysplasia hypohidrotic autosomal dominant or EDA3. ED3 is an autosomal dominant condition characterized by hypotrichosis, abnormal or missing teeth, and hypohidrosis due to the absence of sweat glands.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q13

Cellular Component: apical part of cell; plasma membrane; integral to membrane

Molecular Function: protein binding; transmembrane receptor activity; receptor activity

Biological Process: epidermis development; pigmentation; hair follicle development; apoptosis; positive regulation of NF-kappaB import into nucleus; cell differentiation; signal transduction; odontogenesis of dentine-containing teeth

Disease: Hair Morphology 1; Ectodermal Dysplasia 10a, Hypohidrotic/hair/nail Type, Autosomal Dominant; Ectodermal Dysplasia 10b, Hypohidrotic/hair/tooth Type, Autosomal Recessive