Western Blot (WB)
(Host: RabbitTarget Name: DSESample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Rabbit anti-Human DSE Polyclonal Antibody | anti-DSE antibody
DSE Antibody-middle region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DSE; Polyclonal Antibody; DSE Antibody-middle region; Dermatan-sulfate epimerase; DSEP; DSEPI; SART2; EDSMC2; SART-2; DS-epi1; anti-DSE antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
NRSFLSFKSGKLGGRAIYDIVHRNKYKDWIKGWRNFNAGHEHPDQNSFTF
Applicable Applications for anti-DSE antibody
Western Blot (WB)
Protein Size
958 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DSE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DSESample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DSESample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Related Product Information for anti-DSE antibody
Description of Target: The protein encoded by this gene is a tumor-rejection antigen. It is localized to the endoplasmic reticulum and functions to convert D-glucuronic acid to L-iduronic acid during the biosynthesis of dermatan sulfate. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. Mutations in this gene cause inmusculocontractural Ehlers-Danlos syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 9, and a paralogous gene exists on chromosome 18.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
105kDa
UniProt Protein Name
Dermatan-sulfate epimerase
Protein Family
UniProt Gene Name
DSE
UniProt Synonym Gene Names
SART2; DS epimerase; SART-2
UniProt Entry Name
DSE_HUMAN
Uniprot Description
SART2: Converts D-glucuronic acid to L-iduronic acid (IdoUA) residues. Belongs to the dermatan-sulfate isomerase family.
Protein type: Isomerase; Endoplasmic reticulum; Membrane protein, integral; EC 5.1.3.19; Glycan Metabolism - chondroitin sulfate biosynthesis; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 6q22
Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum; integral to membrane
Molecular Function: chondroitin-glucuronate 5-epimerase activity
Biological Process: chondroitin sulfate metabolic process; chondroitin sulfate biosynthetic process; glycosaminoglycan metabolic process; heparan sulfate proteoglycan biosynthetic process; carbohydrate metabolic process; pathogenesis; dermatan sulfate biosynthetic process
Disease: Ehlers-danlos Syndrome, Musculocontractural Type 2
Similar Products
Product Notes
The DSE dse (Catalog #AAA3249679) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DSE Antibody-middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DSE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DSE dse for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NRSFLSFKSG KLGGRAIYDI VHRNKYKDWI KGWRNFNAGH EHPDQNSFTF. It is sometimes possible for the material contained within the vial of "DSE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
