Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EBF3 monoclonal antibody (M06), clone 1G3. Western Blot analysis of EBF3 expression in IMR-32.)

Mouse EBF3 Monoclonal Antibody | anti-EBF3 antibody

EBF3 (Early B-Cell Factor 3, COE3, O/E-2) (AP)

Gene Names
EBF3; COE3; OE-2; EBF-3; O/E-2
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
EBF3; Monoclonal Antibody; EBF3 (Early B-Cell Factor 3; COE3; O/E-2) (AP); Early B-Cell Factor 3; O/E-2; anti-EBF3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G3
Specificity
Recognizes EBF3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EBF3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EBF3 (NP_001005463, 381aa-480aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(EBF3 monoclonal antibody (M06), clone 1G3. Western Blot analysis of EBF3 expression in IMR-32.)

Western Blot (WB) (EBF3 monoclonal antibody (M06), clone 1G3. Western Blot analysis of EBF3 expression in IMR-32.)

Western Blot (WB)

(EBF3 monoclonal antibody (M06), clone 1G3. Western Blot analysis of EBF3 expression in PC-12.)

Western Blot (WB) (EBF3 monoclonal antibody (M06), clone 1G3. Western Blot analysis of EBF3 expression in PC-12.)
Related Product Information for anti-EBF3 antibody
Mouse monoclonal antibody raised against a partial recombinant EBF3.
Product Categories/Family for anti-EBF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,415 Da
NCBI Official Full Name
transcription factor COE3
NCBI Official Synonym Full Names
early B-cell factor 3
NCBI Official Symbol
EBF3
NCBI Official Synonym Symbols
COE3; OE-2; EBF-3; O/E-2
NCBI Protein Information
transcription factor COE3
UniProt Protein Name
Transcription factor COE3
Protein Family
UniProt Gene Name
EBF3
UniProt Synonym Gene Names
COE3; EBF-3; O/E-2; OE-2
UniProt Entry Name
COE3_HUMAN

NCBI Description

This gene encodes a member of the early B-cell factor (EBF) family of DNA binding transcription factors. EBF proteins are involved in B-cell differentiation, bone development and neurogenesis, and may also function as tumor suppressors. The encoded protein inhibits cell survival through the regulation of genes involved in cell cycle arrest and apoptosis, and aberrant methylation or deletion of this gene may play a role in multiple malignancies including glioblastoma multiforme and gastric carcinoma. [provided by RefSeq, Sep 2011]

Uniprot Description

EBF3: Transcriptional activator which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'. Belongs to the COE family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 10q26.3

Cellular Component: nucleus

Molecular Function: protein dimerization activity; DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; multicellular organismal development

Research Articles on EBF3

Similar Products

Product Notes

The EBF3 ebf3 (Catalog #AAA6163861) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EBF3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EBF3 ebf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EBF3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.