Mouse anti-Human E2F4 Transcription Factor Monoclonal Antibody | anti-E2F-4 antibody

E2F4 Transcription Factor (E2F Transcription Factor 4, E2F4, E2F-4, p107/p130-binding Protein) (HRP)

Cat. Num. AAA6152251

• Gene Names: E2F4; E2F-4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: E2F4 Transcription Factor; Monoclonal Antibody; E2F4 Transcription Factor (E2F Transcription Factor 4; E2F4; E2F-4; p107/p130-binding Protein) (HRP); anti-E2F-4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5B7
• Specificity: Recognizes human E2F4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-E2F-4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa211-301 from human E2F4 (NP_001941) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PPEDLLQSPSAVSTPPPLPKPALAQSQEASRPNSPQLTPTAVPGSAEVQGMAGPAAEITVSGGPGTDSKDSGELSSLPLGPTTLDTRPLQ*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB)

(E2F4 monoclonal antibody, Western Blot analysis of E2F4 expression in A-549.)

Testing Data

(Detection limit for recombinant GST tagged E2F4 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-E2F-4 antibody

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.

Product Categories/Family for anti-E2F-4 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 12669915
• NCBI GeneID: 1874
• NCBI Accession #: NP_001941
• NCBI GenBank Nucleotide #: NM_001950
• UniProt Accession #: Q16254
• Molecular Weight: 44kDa
• NCBI Official Full Name: transcription factor E2F4
• NCBI Official Synonym Full Names: E2F transcription factor 4
• NCBI Official Symbol: E2F4
• NCBI Official Synonym Symbols: E2F-4
• NCBI Protein Information: transcription factor E2F4
• UniProt Protein Name: Transcription factor E2F4
• UniProt Gene Name: E2F4
• UniProt Synonym Gene Names: E2F-4
• UniProt Entry Name: E2F4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

E2F4: Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC- 3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F4 binds with high affinity to RBL1 and RBL2. In some instances can also bind RB1. Belongs to the E2F/DP family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: nucleoplasm; transcription factor complex

Molecular Function: protein domain specific binding; protein binding; DNA binding; transcription factor activity; transcription factor binding

Biological Process: G1/S-specific transcription in mitotic cell cycle; transcription initiation from RNA polymerase II promoter; organ morphogenesis; transcription, DNA-dependent; blood circulation; transforming growth factor beta receptor signaling pathway; epithelial cell development; gene expression; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; cell volume homeostasis; regulation of cell size; regulation of cell proliferation