Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Mouse anti-Human E2F4 Transcription Factor Monoclonal Antibody | anti-E2F-4 antibody

E2F4 Transcription Factor (E2F Transcription Factor 4, E2F4, E2F-4, p107/p130-binding Protein) (AP)

Gene Names
E2F4; E2F-4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
E2F4 Transcription Factor; Monoclonal Antibody; E2F4 Transcription Factor (E2F Transcription Factor 4; E2F4; E2F-4; p107/p130-binding Protein) (AP); anti-E2F-4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B7
Specificity
Recognizes human E2F4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-E2F-4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa211-301 from human E2F4 (NP_001941) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPEDLLQSPSAVSTPPPLPKPALAQSQEASRPNSPQLTPTAVPGSAEVQGMAGPAAEITVSGGPGTDSKDSGELSSLPLGPTTLDTRPLQ*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB)

(E2F4 monoclonal antibody, Western Blot analysis of E2F4 expression in A-549.)

Western Blot (WB) (E2F4 monoclonal antibody, Western Blot analysis of E2F4 expression in A-549.)

Testing Data

(Detection limit for recombinant GST tagged E2F4 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged E2F4 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-E2F-4 antibody
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.
Product Categories/Family for anti-E2F-4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
transcription factor E2F4
NCBI Official Synonym Full Names
E2F transcription factor 4
NCBI Official Symbol
E2F4
NCBI Official Synonym Symbols
E2F-4
NCBI Protein Information
transcription factor E2F4
UniProt Protein Name
Transcription factor E2F4
UniProt Gene Name
E2F4
UniProt Synonym Gene Names
E2F-4
UniProt Entry Name
E2F4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

E2F4: Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC- 3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F4 binds with high affinity to RBL1 and RBL2. In some instances can also bind RB1. Belongs to the E2F/DP family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: nucleoplasm; transcription factor complex

Molecular Function: protein domain specific binding; protein binding; DNA binding; transcription factor activity; transcription factor binding

Biological Process: G1/S-specific transcription in mitotic cell cycle; transcription initiation from RNA polymerase II promoter; organ morphogenesis; transcription, DNA-dependent; blood circulation; transforming growth factor beta receptor signaling pathway; epithelial cell development; gene expression; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; cell volume homeostasis; regulation of cell size; regulation of cell proliferation

Research Articles on E2F-4

Similar Products

Product Notes

The E2F-4 e2f4 (Catalog #AAA6131039) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The E2F4 Transcription Factor (E2F Transcription Factor 4, E2F4, E2F-4, p107/p130-binding Protein) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's E2F4 Transcription Factor can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the E2F-4 e2f4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "E2F4 Transcription Factor, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.