Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.46kD).)

Mouse anti-Human DYX1C1 Monoclonal Antibody | anti-DYX1C1 antibody

DYX1C1 (Dyslexia Susceptibility 1 Candidate Gene 1 Protein, EKN1, FLJ37882, MGC70618, RD)

Gene Names
DYX1C1; RD; DYX1; EKN1; DYXC1
Reactivity
Human
Applications
ELISA, Western Blot, Immunoprecipitation, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DYX1C1; Monoclonal Antibody; DYX1C1 (Dyslexia Susceptibility 1 Candidate Gene 1 Protein; EKN1; FLJ37882; MGC70618; RD); Anti -DYX1C1 (Dyslexia Susceptibility 1 Candidate Gene 1 Protein; anti-DYX1C1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6G1
Specificity
Recognizes human DYX1C1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KLKNLHKAIEDSSKALELLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEKIRNVIQGTELKS
Applicable Applications for anti-DYX1C1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant protein corresponding to aa336-421 from human DYX1C1 (NP_570722) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.46kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.46kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DYX1C1 on HeLa cell . [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DYX1C1 on HeLa cell . [antibody concentration 10ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of DYX1C1 transfected lysate using DYX1C1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with DYX1C1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of DYX1C1 transfected lysate using DYX1C1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with DYX1C1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged DYX1C1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DYX1C1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-DYX1C1 antibody
Involved in neuronal migration during development of the cerebral neocortex. May regulate the stability and proteasomal degradation of the estrogen receptors that play an important role in neuronal differentiation, survival and plasticity.
Product Categories/Family for anti-DYX1C1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,527 Da
NCBI Official Full Name
dyslexia susceptibility 1 candidate gene 1 protein isoform c
NCBI Official Synonym Full Names
dyslexia susceptibility 1 candidate 1
NCBI Official Symbol
DYX1C1
NCBI Official Synonym Symbols
RD; DYX1; EKN1; DYXC1
NCBI Protein Information
dyslexia susceptibility 1 candidate gene 1 protein
UniProt Protein Name
Dyslexia susceptibility 1 candidate gene 1 protein
UniProt Gene Name
DYX1C1
UniProt Synonym Gene Names
EKN1
UniProt Entry Name
DYXC1_HUMAN

NCBI Description

This gene encodes a tetratricopeptide repeat domain-containing protein. The encoded protein interacts with estrogen receptors and the heat shock proteins, Hsp70 and Hsp90. An homologous protein in rat has been shown to function in neuronal migration in the developing neocortex. A chromosomal translocation involving this gene is associated with a susceptibility to developmental dyslexia. Mutations in this gene are associated with deficits in reading and spelling. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream cell cycle progression 1 (CCPG1) gene. [provided by RefSeq, Mar 2011]

Uniprot Description

Function: Involved in neuronal migration during development of the cerebral neocortex. May regulate the stability and proteasomal degradation of the estrogen receptors that play an important role in neuronal differentiation, survival and plasticity. Ref.6

Subunit structure: Interacts with ESR1 and ESR2. Interacts with STUB1. Ref.6

Subcellular location: Nucleus. Cytoplasm Ref.1 Ref.5 Ref.6.

Tissue specificity: Expressed in several tissues, including brain, lung, kidney and testis. In brain localizes to a fraction of cortical neurons and white matter glial cells. Ref.1

Involvement in disease: Dyslexia 1 (DYX1) [MIM:127700]: A relatively common, complex cognitive disorder characterized by an impairment of reading performance despite adequate motivational, educational and intellectual opportunities. It is a multifactorial trait, with evidence for familial clustering and heritability.Note: Disease susceptibility is associated with variations affecting the gene represented in this entry. A chromosomal aberration involving DYX1C1 has been found in a family affected by dyslexia. Translocation t(2;15)(q11;q21).

Sequence similarities: Contains 1 CS domain.Contains 3 TPR repeats.

Research Articles on DYX1C1

Similar Products

Product Notes

The DYX1C1 dyx1c1 (Catalog #AAA647157) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DYX1C1 (Dyslexia Susceptibility 1 Candidate Gene 1 Protein, EKN1, FLJ37882, MGC70618, RD) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DYX1C1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the DYX1C1 dyx1c1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KLKNLHKAIE DSSKALELLM PPVTDNANAR MKAHVRRGTA FCQLELYVEG LQDYEAALKI DPSNKIVQID AEKIRNVIQG TELKS. It is sometimes possible for the material contained within the vial of "DYX1C1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.