Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DTYMK monoclonal antibody (M02), clone 2G11. Western Blot analysis of DTYMK expression in HeLa.)

Mouse DTYMK Monoclonal Antibody | anti-DTYMK antibody

DTYMK (deoxythymidylate Kinase (thymidylate Kinase), CDC8, FLJ44192, TMPK, TYMK) (HRP)

Gene Names
DTYMK; CDC8; TMPK; TYMK; PP3731
Applications
Western Blot
Purity
Purified
Synonyms
DTYMK; Monoclonal Antibody; DTYMK (deoxythymidylate Kinase (thymidylate Kinase); CDC8; FLJ44192; TMPK; TYMK) (HRP); deoxythymidylate Kinase (thymidylate Kinase); TYMK; anti-DTYMK antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G11
Specificity
Recognizes DTYMK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DTYMK antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DTYMK (NP_036277, 103aa-212aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGELWK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DTYMK monoclonal antibody (M02), clone 2G11. Western Blot analysis of DTYMK expression in HeLa.)

Western Blot (WB) (DTYMK monoclonal antibody (M02), clone 2G11. Western Blot analysis of DTYMK expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged DTYMK is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DTYMK is 0.3 ng/ml as a capture antibody.)
Product Categories/Family for anti-DTYMK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26 kDa (232aa), confirmed by MALDI-TOF
NCBI Official Full Name
thymidylate kinase isoform 1
NCBI Official Synonym Full Names
deoxythymidylate kinase
NCBI Official Symbol
DTYMK
NCBI Official Synonym Symbols
CDC8; TMPK; TYMK; PP3731
NCBI Protein Information
thymidylate kinase
UniProt Protein Name
Thymidylate kinase
UniProt Gene Name
DTYMK
UniProt Synonym Gene Names
CDC8; TMPK; TYMK
UniProt Entry Name
KTHY_HUMAN

Uniprot Description

DTYMK: Catalyzes the conversion of dTMP to dTDP. Belongs to the thymidylate kinase family.

Protein type: EC 2.7.4.9; Nucleotide Metabolism - pyrimidine; Mitochondrial; Kinase, other

Chromosomal Location of Human Ortholog: 2q37.3

Cellular Component: mitochondrion; mitochondrial matrix; mitochondrial intermembrane space; cytosol; nucleus

Molecular Function: uridylate kinase activity; thymidylate kinase activity; nucleoside phosphate kinase activity; ATP binding

Biological Process: myoblast differentiation; cell proliferation; response to cadmium ion; dUDP biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; nucleoside monophosphate phosphorylation; response to estrogen stimulus; nucleobase, nucleoside and nucleotide interconversion; dTDP biosynthetic process; dTTP biosynthetic process; cell cycle; nucleotide phosphorylation

Research Articles on DTYMK

Similar Products

Product Notes

The DTYMK dtymk (Catalog #AAA6183265) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DTYMK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DTYMK dtymk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DTYMK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.