Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human DPYSL5 Monoclonal Antibody | anti-DPYSL5 antibody

DPYSL5 (Dihydropyrimidinase-related Protein 5, DRP-5, CRMP3-associated Molecule, CRAM, Collapsin Response Mediator Protein 5, CRMP-5, UNC33-like Phosphoprotein 6, ULIP-6, CRMP5, ULIP6)

Gene Names
DPYSL5; CRAM; CRMP5; Ulip6; CRMP-5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DPYSL5; Monoclonal Antibody; DPYSL5 (Dihydropyrimidinase-related Protein 5; DRP-5; CRMP3-associated Molecule; CRAM; Collapsin Response Mediator Protein 5; CRMP-5; UNC33-like Phosphoprotein 6; ULIP-6; CRMP5; ULIP6); Anti -DPYSL5 (Dihydropyrimidinase-related Protein 5; anti-DPYSL5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2G4
Specificity
Recognizes human DPYSL5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW
Applicable Applications for anti-DPYSL5 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa466-565 from human DPYSL5 (NP_064519) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of DPYSL5 expression in transfected 293T cell line by DPYSL5 monoclonal antibody.|Lane 1: DPYSL5 transfected lysate (61.4kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DPYSL5 expression in transfected 293T cell line by DPYSL5 monoclonal antibody.|Lane 1: DPYSL5 transfected lysate (61.4kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged DPYSL5 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DPYSL5 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-DPYSL5 antibody
The collapsin response mediator protein (CRMP) family of proteins (also referred to as ULIP6) are a group of neurologic proteins that have been found to play key roles in growth cone guidance during neural development. CRMP5 has relatively low sequence homology with the other four members of the CRMP family. CRMP5 is expressed in the developing nervous system in an expression pattern that resembles CRMP2 and has a peak expression during the first postnatal week. Elevated levels of autoantibody to CRMP5 have been shown to be linked paraneoplastic autoimmune optic neuritis and other paraneoplastic neoplasms. Auto-immunity against CRMP5 expression (predominantly the N-terminal epitopes) is also being investigated as an oncological marker in the respiratory system and in the thymus.
Product Categories/Family for anti-DPYSL5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
61,421 Da
NCBI Official Full Name
DPYSL5 protein
NCBI Official Synonym Full Names
dihydropyrimidinase-like 5
NCBI Official Symbol
DPYSL5
NCBI Official Synonym Symbols
CRAM; CRMP5; Ulip6; CRMP-5
NCBI Protein Information
dihydropyrimidinase-related protein 5; DRP-5; ULIP-6; CRMP3-associated molecule; UNC33-like phosphoprotein 6; collapsin response mediator protein 5; collapsin response mediator protein-5
UniProt Protein Name
Dihydropyrimidinase-related protein 5
UniProt Gene Name
DPYSL5
UniProt Synonym Gene Names
CRMP5; ULIP6; DRP-5; CRAM; CRMP-5; ULIP-6
UniProt Entry Name
DPYL5_HUMAN

NCBI Description

This gene encodes a member of the CRMP (collapsing response mediator protein) family thought to be involved in neural development. Antibodies to the encoded protein were found in some patients with neurologic symptoms who had paraneoplastic syndrome. A pseudogene of this gene is found on chromosome 11. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011]

Uniprot Description

CRMP-5: May have a function in neuronal differentiation and/or axon growth. Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily.

Chromosomal Location of Human Ortholog: 2p23.3

Cellular Component: cell soma; dendrite; cytosol

Molecular Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides

Biological Process: axon guidance; nervous system development; signal transduction; pyrimidine base catabolic process

Research Articles on DPYSL5

Similar Products

Product Notes

The DPYSL5 dpysl5 (Catalog #AAA6013319) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DPYSL5 (Dihydropyrimidinase-related Protein 5, DRP-5, CRMP3-associated Molecule, CRAM, Collapsin Response Mediator Protein 5, CRMP-5, UNC33-like Phosphoprotein 6, ULIP-6, CRMP5, ULIP6) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DPYSL5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the DPYSL5 dpysl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SFPDTVYKKL VQREKTLKVR GVDRTPYLGD VAVVVHPGKK EMGTPLADTP TRPVTRHGGM RDLHESSFSL SGSQIDDHVP KRASARILAP PGGRSSGIW. It is sometimes possible for the material contained within the vial of "DPYSL5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.