Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DOCK1 Monoclonal Antibody | anti-DOCK1 antibody

DOCK1 (Dedicator of Cytokinesis Protein 1, 180kD Protein Downstream of CRK, DOCK180) (MaxLight 650)

Gene Names
DOCK1; ced5; DOCK180
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DOCK1; Monoclonal Antibody; DOCK1 (Dedicator of Cytokinesis Protein 1; 180kD Protein Downstream of CRK; DOCK180) (MaxLight 650); anti-DOCK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D10
Specificity
Recognizes human DOCK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-DOCK1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa698-803 from human DOCK1 (NP_001371) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPT
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DOCK1 antibody
DOCK1 binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis.
Product Categories/Family for anti-DOCK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
215,346 Da
NCBI Official Full Name
dedicator of cytokinesis protein 1 isoform 2
NCBI Official Synonym Full Names
dedicator of cytokinesis 1
NCBI Official Symbol
DOCK1
NCBI Official Synonym Symbols
ced5; DOCK180
NCBI Protein Information
dedicator of cytokinesis protein 1; 180 kDa protein downstream of CRK; DOwnstream of CrK
UniProt Protein Name
Dedicator of cytokinesis protein 1
UniProt Gene Name
DOCK1
UniProt Synonym Gene Names
DOCK180
UniProt Entry Name
DOCK1_HUMAN

Uniprot Description

DOCK1: Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Functions as a guanine nucleotide exchange factor (GEF), which activates Rac Rho small GTPases by exchanging bound GDP for free GTP. Its GEF activity may be enhanced by ELMO1. Interacts with the SH3 domains of CRK and NCK2 via multiple sites. Interacts with nucleotide-free RAC1 via its DHR-2 domain. Interacts with ELMO1, ELMO2 and probably ELMO3 via its SH3 domain. Interacts with RAC1 and BAI1. Highly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon. Belongs to the DOCK family.

Protein type: GEFs, Rac/Rho; Cytoskeletal; Motility/polarity/chemotaxis; Adaptor/scaffold; GEFs

Chromosomal Location of Human Ortholog: 10q26.13-q26.3

Cellular Component: nucleoplasm; membrane; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; guanyl-nucleotide exchange factor activity; SH3 domain binding; GTPase activator activity

Biological Process: integrin-mediated signaling pathway; axon guidance; cell migration; apoptosis; small GTPase mediated signal transduction; innate immune response; hemopoietic progenitor cell differentiation; vascular endothelial growth factor receptor signaling pathway; blood coagulation; signal transduction; phagocytosis, engulfment; positive regulation of GTPase activity

Similar Products

Product Notes

The DOCK1 dock1 (Catalog #AAA6221874) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DOCK1 (Dedicator of Cytokinesis Protein 1, 180kD Protein Downstream of CRK, DOCK180) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DOCK1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DOCK1 dock1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DOCK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.