Mouse anti-Human DOCK1 Monoclonal Antibody | anti-DOCK1 antibody

DOCK1 (Dedicator of Cytokinesis Protein 1, 180kD Protein Downstream of CRK, DOCK180) (Biotin)

Cat. Num. AAA6141592

• Gene Names: DOCK1; ced5; DOCK180
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DOCK1; Monoclonal Antibody; DOCK1 (Dedicator of Cytokinesis Protein 1; 180kD Protein Downstream of CRK; DOCK180) (Biotin); anti-DOCK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3D10
• Specificity: Recognizes human DOCK1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-DOCK1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa698-803 from human DOCK1 (NP_001371) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPT
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DOCK1 monoclonal antibody. Western Blot analysis of DOCK1 expression in human colon.)

Related Product Information for anti-DOCK1 antibody

DOCK1 binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis.

Product Categories/Family for anti-DOCK1 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 4503355
• NCBI GeneID: 1793
• NCBI Accession #: NP_001371
• NCBI GenBank Nucleotide #: NM_001380
• UniProt Accession #: Q14185; A9Z1Z5
• Molecular Weight: 215,346 Da
• NCBI Official Full Name: dedicator of cytokinesis protein 1 isoform 2
• NCBI Official Synonym Full Names: dedicator of cytokinesis 1
• NCBI Official Symbol: DOCK1
• NCBI Official Synonym Symbols: ced5; DOCK180
• NCBI Protein Information: dedicator of cytokinesis protein 1; 180 kDa protein downstream of CRK; DOwnstream of CrK
• UniProt Protein Name: Dedicator of cytokinesis protein 1
• Protein Family: Dedicator of cytokinesis protein
• UniProt Gene Name: DOCK1
• UniProt Synonym Gene Names: DOCK180
• UniProt Entry Name: DOCK1_HUMAN

Uniprot Description

DOCK1: Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Functions as a guanine nucleotide exchange factor (GEF), which activates Rac Rho small GTPases by exchanging bound GDP for free GTP. Its GEF activity may be enhanced by ELMO1. Interacts with the SH3 domains of CRK and NCK2 via multiple sites. Interacts with nucleotide-free RAC1 via its DHR-2 domain. Interacts with ELMO1, ELMO2 and probably ELMO3 via its SH3 domain. Interacts with RAC1 and BAI1. Highly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon. Belongs to the DOCK family.

Protein type: GEFs, Rac/Rho; Cytoskeletal; Motility/polarity/chemotaxis; Adaptor/scaffold; GEFs

Chromosomal Location of Human Ortholog: 10q26.13-q26.3

Cellular Component: nucleoplasm; membrane; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; guanyl-nucleotide exchange factor activity; SH3 domain binding; GTPase activator activity

Biological Process: integrin-mediated signaling pathway; axon guidance; cell migration; apoptosis; small GTPase mediated signal transduction; innate immune response; hemopoietic progenitor cell differentiation; vascular endothelial growth factor receptor signaling pathway; blood coagulation; signal transduction; phagocytosis, engulfment; positive regulation of GTPase activity