Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)

Mouse anti-Human DLL1 Monoclonal Antibody | anti-DLL1 antibody

DLL1 (Delta-like Protein 1, Drosophila Delta Homolog 1, Delta1, H-Delta-1, UNQ146/PRO172) (PE)

Gene Names
DLL1; DL1; Delta; DELTA1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DLL1; Monoclonal Antibody; DLL1 (Delta-like Protein 1; Drosophila Delta Homolog 1; Delta1; H-Delta-1; UNQ146/PRO172) (PE); anti-DLL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F8
Specificity
Recognizes human DLL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-DLL1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa18-110 from human DLL1 (NP_005609) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.23kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DLL1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DLL1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged DLL1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DLL1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-DLL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
delta-like protein 1
NCBI Official Synonym Full Names
delta like canonical Notch ligand 1
NCBI Official Symbol
DLL1
NCBI Official Synonym Symbols
DL1; Delta; DELTA1
NCBI Protein Information
delta-like protein 1
UniProt Protein Name
Delta-like protein 1
Protein Family
UniProt Gene Name
DLL1
UniProt Synonym Gene Names
Delta1; H-Delta-1
UniProt Entry Name
DLL1_HUMAN

NCBI Description

DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. [provided by RefSeq, Jul 2008]

Uniprot Description

DLL1: Acts as a ligand for Notch receptors. Blocks the differentiation of progenitor cells into the B-cell lineage while promoting the emergence of a population of cells with the characteristics of a T-cell/NK-cell precursor. Interacts with Notch receptors. Expressed in heart and pancreas, with lower expression in brain and muscle and almost no expression in placenta, lung, liver and kidney.

Protein type: Cell development/differentiation; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6q27

Cellular Component: integral to plasma membrane; extracellular region; plasma membrane; cytoplasmic vesicle

Molecular Function: protein binding; calcium ion binding; Notch binding

Biological Process: regulation of cell adhesion; Notch signaling pathway; negative regulation of myeloid cell differentiation; negative regulation of interleukin-10 production; Notch receptor processing; cell fate determination; compartment specification; somite specification; cell-cell signaling; negative regulation of auditory receptor cell differentiation; hemopoiesis; positive regulation of transcription from RNA polymerase II promoter; heart looping; determination of left/right symmetry; cell differentiation; inner ear development; positive regulation of Notch signaling pathway

Research Articles on DLL1

Similar Products

Product Notes

The DLL1 dll1 (Catalog #AAA6157464) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DLL1 (Delta-like Protein 1, Drosophila Delta Homolog 1, Delta1, H-Delta-1, UNQ146/PRO172) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DLL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DLL1 dll1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DLL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.