Mouse anti-Human DDX41 Monoclonal Antibody | anti-DDX41 antibody

DDX41 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41, DEAD Box Protein 41, DDX-41, DEAD-box Protein Abstrakt, ABS, MGC8828) (Biotin)

Cat. Num. AAA6141504

• Gene Names: DDX41; ABS
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DDX41; Monoclonal Antibody; DDX41 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41; DEAD Box Protein 41; DDX-41; DEAD-box Protein Abstrakt; ABS; MGC8828) (Biotin); anti-DDX41 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F4
• Specificity: Recognizes human DDX41.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-DDX41 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa523-623 from human DDX41 (NP_057306) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(DDX41 monoclonal antibody, Western Blot analysis of DDX41 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of DDX41 expression in transfected 293T cell line by DDX41 monoclonal antibody. Lane 1: DDX41 transfected lysate (7kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DDX41 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DDX41 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-DDX41 antibody

Antibodies; DEAD Box Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21071032
• NCBI GeneID: 51428
• NCBI Accession #: NP_057306
• NCBI GenBank Nucleotide #: NM_016222
• UniProt Accession #: Q9UJV9; Q96BK6; Q96K05; Q9NT96; Q9NW04; B2RDC8
• Molecular Weight: Predicted: 68 kDa; ; Observed: 70 kDa
• NCBI Official Full Name: probable ATP-dependent RNA helicase DDX41
• NCBI Official Synonym Full Names: DEAD (Asp-Glu-Ala-Asp) box polypeptide 41
• NCBI Official Symbol: DDX41
• NCBI Official Synonym Symbols: ABS
• NCBI Protein Information: probable ATP-dependent RNA helicase DDX41; 2900024F02Rik; DEAD box protein 41; putative RNA helicase; DEAD-box protein abstrakt; DEAD box protein abstrakt homolog
• UniProt Protein Name: Probable ATP-dependent RNA helicase DDX41
• Protein Family: Probable ATP-dependent RNA helicase
• UniProt Gene Name: DDX41
• UniProt Synonym Gene Names: ABS
• UniProt Entry Name: DDX41_HUMAN

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Based on studies in Drosophila, the abstrakt gene is widely required during post-transcriptional gene expression. [provided by RefSeq, Jul 2008]

Uniprot Description

DDX41: Probable ATP-dependent RNA helicase. Is required during post-transcriptional gene expression. May be involved in pre-mRNA splicing. Belongs to the DEAD box helicase family. DDX41 subfamily.

Protein type: Spliceosome; RNA-binding; RNA splicing; EC 3.6.4.13; Helicase

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: membrane; endoplasmic reticulum; cytosol

Molecular Function: protein binding; DNA binding; zinc ion binding; helicase activity; ATP binding

Biological Process: RNA processing; nuclear mRNA splicing, via spliceosome; regulation of interferon type I production; apoptosis; multicellular organismal development; positive regulation of interferon type I production; innate immune response; positive regulation of transcription from RNA polymerase II promoter; defense response to virus