Western Blot (WB)
(Western Blot detection against Immunogen (38.72kD).)
Mouse anti-Human DDT Monoclonal Antibody | anti-DDT antibody
DDT (D-dopachrome Decarboxylase, D-dopachrome Tautomerase, Phenylpyruvate Tautomerase II) (AP)
Gene Names
DDT; D-DT; DDCT; MIF2; MIF-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DDT; Monoclonal Antibody; DDT (D-dopachrome Decarboxylase; D-dopachrome Tautomerase; Phenylpyruvate Tautomerase II) (AP); anti-DDT antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G1
Specificity
Recognizes human DDT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
591
Applicable Applications for anti-DDT antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-118 from human DDT (AAH05971) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.72kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.72kD).)
Western Blot (WB)
(Western Blot analysis of DDT expression in transfected 293T cell line by DDT monoclonal antibody. Lane 1: DDT transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of DDT expression in transfected 293T cell line by DDT monoclonal antibody. Lane 1: DDT transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged DDT is ~3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged DDT is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-DDT antibody
References
1. D-dopachrome tautomerase is a candidate for key proteins to protect the rat liver damaged by carbon tetrachloride. Hiyoshi M, Konishi H, Uemura H, Matsuzaki H, Tsukamoto H, Sugimoto R, Takeda H, Dakeshita S, Kitayama A, Takami H, Sawachika F, Kido H, Arisawa K.Toxicology. 2009 Jan 8;255(1-2):6-14. Epub 2008 Sep 27.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens D-dopachrome tautomerase, mRNA
NCBI Official Synonym Full Names
D-dopachrome tautomerase
NCBI Official Symbol
DDT
NCBI Official Synonym Symbols
D-DT; DDCT; MIF2; MIF-2
NCBI Protein Information
D-dopachrome decarboxylase
Protein Family
NCBI Description
D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008]
Research Articles on DDT
Similar Products
Product Notes
The DDT (Catalog #AAA6130892) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DDT (D-dopachrome Decarboxylase, D-dopachrome Tautomerase, Phenylpyruvate Tautomerase II) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
