Mouse anti-Human DDT Monoclonal Antibody | anti-DDT antibody

DDT (D-dopachrome Decarboxylase, D-dopachrome Tautomerase, Phenylpyruvate Tautomerase II) (HRP)

Cat. Num. AAA6152104

• Gene Names: DDT; D-DT; DDCT; MIF2; MIF-2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DDT; Monoclonal Antibody; DDT (D-dopachrome Decarboxylase; D-dopachrome Tautomerase; Phenylpyruvate Tautomerase II) (HRP); anti-DDT antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1G1
• Specificity: Recognizes human DDT.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 591

• Applicable Applications for anti-DDT antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-118 from human DDT (AAH05971) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.72kD).)

Western Blot (WB)

(Western Blot analysis of DDT expression in transfected 293T cell line by DDT monoclonal antibody. Lane 1: DDT transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged DDT is ~3ng/ml as a capture antibody.)

Product Categories/Family for anti-DDT antibody

Antibodies; Enzymes; Decarboxylase

References

1. D-dopachrome tautomerase is a candidate for key proteins to protect the rat liver damaged by carbon tetrachloride. Hiyoshi M, Konishi H, Uemura H, Matsuzaki H, Tsukamoto H, Sugimoto R, Takeda H, Dakeshita S, Kitayama A, Takami H, Sawachika F, Kido H, Arisawa K.Toxicology. 2009 Jan 8;255(1-2):6-14. Epub 2008 Sep 27.

NCBI and Uniprot Product Information

• NCBI GI #: 13543644
• NCBI GeneID: 1652
• NCBI Official Full Name: Homo sapiens D-dopachrome tautomerase, mRNA
• NCBI Official Synonym Full Names: D-dopachrome tautomerase
• NCBI Official Symbol: DDT
• NCBI Official Synonym Symbols: D-DT; DDCT; MIF2; MIF-2
• NCBI Protein Information: D-dopachrome decarboxylase
• Protein Family: D-dopachrome decarboxylase

NCBI Description

D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008]