Western Blot (WB)
(DDT rabbit polyclonal antibody. Western Blot analysis of DDT expression in human spleen.)
Rabbit anti-Human DDT Polyclonal Antibody | anti-DDT antibody
DDT (D-dopachrome Decarboxylase, D-dopachrome Tautomerase, Phenylpyruvate Tautomerase II) (AP)
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DDT; Polyclonal Antibody; DDT (D-dopachrome Decarboxylase; D-dopachrome Tautomerase; Phenylpyruvate Tautomerase II) (AP); anti-DDT antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DDT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DDT antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DDT, aa1-118 (NP_001346.1).
Immunogen Sequence
MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(DDT rabbit polyclonal antibody. Western Blot analysis of DDT expression in human spleen.)
Western Blot (WB)
(DDT rabbit polyclonal antibody. Western Blot analysis of DDT expression in human spleen.)
Western Blot (WB)
(Western Blot analysis of DDT expression in transfected 293T cell line by DDT polyclonal antibody. Lane 1: DDT transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of DDT expression in transfected 293T cell line by DDT polyclonal antibody. Lane 1: DDT transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DDT antibody
Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).
Product Categories/Family for anti-DDT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
D-dopachrome decarboxylase
UniProt Protein Name
D-dopachrome decarboxylase
Protein Family
UniProt Gene Name
DDT
UniProt Entry Name
DOPD_HUMAN
Uniprot Description
DDT: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI). Belongs to the MIF family.
Protein type: EC 4.1.1.84; Lyase
Chromosomal Location of Human Ortholog: 22q11.23
Cellular Component: cytoplasm
Molecular Function: D-dopachrome decarboxylase activity; dopachrome isomerase activity
Biological Process: melanin biosynthetic process
Similar Products
Product Notes
The DDT ddt (Catalog #AAA6375875) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDT (D-dopachrome Decarboxylase, D-dopachrome Tautomerase, Phenylpyruvate Tautomerase II) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDT ddt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
