Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.66kD).)

Mouse anti-Human DDAH1 Monoclonal Antibody | anti-DDAH1 antibody

DDAH1 (N(G),N(G)-dimethylarginine Dimethylaminohydrolase 1, DDAH-1, Dimethylarginine Dimethylaminohydrolase 1, DDAHI, Dimethylargininase-1, DDAH) APC

Gene Names
DDAH1; DDAH; DDAHI; DDAH-1; HEL-S-16
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DDAH1; Monoclonal Antibody; DDAH1 (N(G); N(G)-dimethylarginine Dimethylaminohydrolase 1; DDAH-1; Dimethylarginine Dimethylaminohydrolase 1; DDAHI; Dimethylargininase-1; DDAH) APC; anti-DDAH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F7
Specificity
Recognizes human DDAH1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DDAH1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa181-286 from DDAH1 (NP_036269) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.66kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.66kD).)
Related Product Information for anti-DDAH1 antibody
DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
Product Categories/Family for anti-DDAH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.5 kDa (308aa) confirmed by MALDI-TOF
NCBI Official Full Name
N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 isoform 1
NCBI Official Synonym Full Names
dimethylarginine dimethylaminohydrolase 1
NCBI Official Symbol
DDAH1
NCBI Official Synonym Symbols
DDAH; DDAHI; DDAH-1; HEL-S-16
NCBI Protein Information
N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
UniProt Protein Name
N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
UniProt Gene Name
DDAH1
UniProt Synonym Gene Names
DDAH; DDAH-1; Dimethylarginine dimethylaminohydrolase 1
UniProt Entry Name
DDAH1_HUMAN

NCBI Description

This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. [provided by RefSeq, Jul 2008]

Uniprot Description

DDAH1: Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation. Belongs to the DDAH family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.3.18; Hydrolase

Chromosomal Location of Human Ortholog: 1p22

Cellular Component: mitochondrion

Molecular Function: amino acid binding; dimethylargininase activity; metal ion binding; catalytic activity

Biological Process: positive regulation of angiogenesis; positive regulation of nitric oxide biosynthetic process; citrulline metabolic process; regulation of systemic arterial blood pressure; arginine catabolic process; nitric oxide mediated signal transduction

Research Articles on DDAH1

Similar Products

Product Notes

The DDAH1 ddah1 (Catalog #AAA6136188) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DDAH1 (N(G),N(G)-dimethylarginine Dimethylaminohydrolase 1, DDAH-1, Dimethylarginine Dimethylaminohydrolase 1, DDAHI, Dimethylargininase-1, DDAH) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDAH1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDAH1 ddah1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDAH1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.