Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ALAS1Sample Type: 293T Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ALAS1 Polyclonal Antibody | anti-ALAS1 antibody

ALAS1 Antibody - N-terminal region

Gene Names
ALAS1; ALAS; MIG4; ALAS3; ALASH; ALAS-H
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ALAS1; Polyclonal Antibody; ALAS1 Antibody - N-terminal region; anti-ALAS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGH
Sequence Length
640
Applicable Applications for anti-ALAS1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALAS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ALAS1Sample Type: 293T Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ALAS1Sample Type: 293T Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ALAS1 antibody
This is a rabbit polyclonal antibody against ALAS1. It was validated on Western Blot

Target Description: This gene encodes the mitochondrial enzyme which is catalyzes the rate-limiting step in heme (iron-protoporphyrin) biosynthesis. The enzyme encoded by this gene is the housekeeping enzyme; a separate gene encodes a form of the enzyme that is specific for erythroid tissue. The level of the mature encoded protein is regulated by heme: high levels of heme down-regulate the mature enzyme in mitochondria while low heme levels up-regulate. A pseudogene of this gene is located on chromosome 12. Multiple alternatively spliced variants, encoding the same protein, have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
211
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Synonym Full Names
5'-aminolevulinate synthase 1
NCBI Official Symbol
ALAS1
NCBI Official Synonym Symbols
ALAS; MIG4; ALAS3; ALASH; ALAS-H
NCBI Protein Information
5-aminolevulinate synthase, nonspecific, mitochondrial
UniProt Protein Name
5-aminolevulinate synthase, nonspecific, mitochondrial
Protein Family
UniProt Gene Name
ALAS1
UniProt Synonym Gene Names
ALAS3; ALASH; ALAS-H
UniProt Entry Name
HEM1_HUMAN

NCBI Description

This gene encodes the mitochondrial enzyme which is catalyzes the rate-limiting step in heme (iron-protoporphyrin) biosynthesis. The enzyme encoded by this gene is the housekeeping enzyme; a separate gene encodes a form of the enzyme that is specific for erythroid tissue. The level of the mature encoded protein is regulated by heme: high levels of heme down-regulate the mature enzyme in mitochondria while low heme levels up-regulate. A pseudogene of this gene is located on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015]

Uniprot Description

ALAS1: the mitochondrial enzyme which is catalyzes the rate-limiting step in heme (iron-protoporphyrin) biosynthesis. The enzyme encoded by this gene is the housekeeping enzyme; a separate gene encodes a form of the enzyme that is specific for erythroid tissue. The level of the mature encoded protein is regulated by heme: high levels of heme down-regulate the mature enzyme in mitochondria while low heme levels up-regulate. A pseudogene of this gene is located on chromosome 12. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011]

Protein type: Transferase; Amino Acid Metabolism - glycine, serine and threonine; Mitochondrial; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; EC 2.3.1.37

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; cytoplasm

Molecular Function: 5-aminolevulinate synthase activity; pyridoxal phosphate binding

Biological Process: mitochondrion organization and biogenesis; organelle organization and biogenesis; porphyrin metabolic process; cellular lipid metabolic process; protoporphyrinogen IX biosynthetic process; heme biosynthetic process

Research Articles on ALAS1

Similar Products

Product Notes

The ALAS1 alas1 (Catalog #AAA3219133) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALAS1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALAS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALAS1 alas1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RALSTAAVHY QQIKETPPAS EKDKTAKAKV QQTPDGSQQS PDGTQLPSGH. It is sometimes possible for the material contained within the vial of "ALAS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.