Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.96kD).)

Mouse anti-Human DAP1 Monoclonal Antibody | anti-DAP1 antibody

DAP1 (Death-associated Protein 1, DAP-1, DAP) APC

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DAP1; Monoclonal Antibody; DAP1 (Death-associated Protein 1; DAP-1; DAP) APC; anti-DAP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C5
Specificity
Recognizes human DAP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DAP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-102 from DAP (AAH02726) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.96kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.96kD).)

Testing Data

(Detection limit for recombinant GST tagged DAP is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DAP is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-DAP1 antibody
Death Associated Protein 1 (DAP1) is a 15kD protein that functions as a positive mediator of cell death initiated by interferon-gamma. The DAP1 protein is proline-rich and possesses one SH3 binding motif, as well as several consensus protein kinase phosphorylation sites. The protein is localized in the cytoplasm, however the detailed mechanism of its proapoptotic function is unclear.
Product Categories/Family for anti-DAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
11,165 Da
NCBI Official Full Name
Homo sapiens death-associated protein, mRNA
NCBI Official Synonym Full Names
death associated protein
NCBI Official Symbol
DAP
NCBI Protein Information
death-associated protein 1
UniProt Protein Name
Death-associated protein 1
Protein Family
UniProt Gene Name
DAP
UniProt Synonym Gene Names
DAP1; DAP-1
UniProt Entry Name
DAP1_HUMAN

NCBI Description

This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]

Uniprot Description

DAP: a 15 kDa, proline rich protein that possesses one SH3 binding motif. Negatively regulates autophagy and is involved in mediating interferon-gamma-induced cell death. Localizes in the cytoplasm, but the detailed mechanism of its proapoptotic function is unclear.

Protein type: Autophagy

Chromosomal Location of Human Ortholog: 5p15.2

Biological Process: apoptosis; caspase activation; cellular response to amino acid starvation; inhibition of NF-kappaB transcription factor; negative regulation of autophagy; negative regulation of transcription, DNA-dependent

Research Articles on DAP1

Similar Products

Product Notes

The DAP1 dap (Catalog #AAA6136159) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DAP1 (Death-associated Protein 1, DAP-1, DAP) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DAP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DAP1 dap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.