Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Homeobox protein MOX-1 (MEOX1) Recombinant Protein | MEOX1 recombinant protein

Recombinant Human Homeobox protein MOX-1 (MEOX1)

Gene Names
MEOX1; KFS2; MOX1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Homeobox protein MOX-1 (MEOX1); Recombinant Human Homeobox protein MOX-1 (MEOX1); Homeobox protein MOX-1; Mesenchyme homeobox 1; MEOX1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-254aa; Full Length
Sequence
MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE
Sequence Length
254
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for MEOX1 recombinant protein
Mesodermal transcription factor that plays a key role in somitogenesis and is specifically required for sclerotome development. Required for maintenance of the sclerotome polarity and formation of the cranio-cervical joints. Binds specifically to the promoter of target genes and regulates their expression. Activates expression of NKX3-2 in the sclerotome. Activates expression of CDKN1A and CDKN2A in endothelial cells, acting as a regulator of vascular cell proliferation. While it activates CDKN1A in a DNA-dependent manner, it activates CDKN2A in a DNA-independent manner. Required for hematopoietic stem cell (HSCs) induction via its role in somitogenesis: specification of HSCs occurs via the deployment of a specific endothelial precursor population, which arises within a sub-compartment of the somite named endotome.
Product Categories/Family for MEOX1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
homeobox protein MOX-1 isoform 3
NCBI Official Synonym Full Names
mesenchyme homeobox 1
NCBI Official Symbol
MEOX1
NCBI Official Synonym Symbols
KFS2; MOX1
NCBI Protein Information
homeobox protein MOX-1
UniProt Protein Name
Homeobox protein MOX-1
Protein Family
UniProt Gene Name
MEOX1
UniProt Synonym Gene Names
MOX1
UniProt Entry Name
MEOX1_HUMAN

NCBI Description

This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

MEOX1: Role in mesoderm induction and its earliest regional specification, somitogenesis, and myogenic and sclerotomal differentiation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: cytoplasm; nucleus

Molecular Function: sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: somite specification; transcription, DNA-dependent; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter

Disease: Klippel-feil Syndrome 2, Autosomal Recessive

Research Articles on MEOX1

Similar Products

Product Notes

The MEOX1 meox1 (Catalog #AAA963418) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-254aa; Full Length. The amino acid sequence is listed below: MDPAASSCMR SLQPPAPVWG CLRNPHSEGN GASGLPHYPP TPFSFHQKPD FLATATAAYP DFSASCLAAT PHSLPQEEHI FTEQHPAFPQ SPNWHFPVSD ARRRPNSGPA GGSKEMGTSS LGLVDTTGGP GDDYGVLGST ANETEKKSSR RRKESSDNQE NRGKPEGSSK ARKERTAFTK EQLRELEAEF AHHNYLTRLR RYEIAVNLDL SERQVKVWFQ NRRMKWKRVK GGQPISPNGQ DPEDGDSTAS PSSE. It is sometimes possible for the material contained within the vial of "Homeobox protein MOX-1 (MEOX1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.