Mouse anti-Human, Rat DAAM1 Monoclonal Antibody | anti-DAAM1 antibody

DAAM1 (Disheveled-associated Activator Of Morphogenesis 1, KIAA0666) (AP)

Cat. Num. AAA6130851

• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DAAM1; Monoclonal Antibody; DAAM1 (Disheveled-associated Activator Of Morphogenesis 1; KIAA0666) (AP); anti-DAAM1 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H3
• Specificity: Recognizes human DAAM1. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-DAAM1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-111 from DAAM1 (NP_055807) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL*
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(DAAM1 monoclonal antibody Western Blot analysis of DAAM1 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody. Lane 1: DAAM1 transfected lysate (122.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged DAAM1 is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between RHOA and DAAM1 HeLa cells were stained with RHOA rabbit purified polyclonal 1:1200 and DAAM1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Western Blot (WB)

(DAAM1 monoclonal antibody Western Blot analysis of DAAM1 expression in A-431.)

Related Product Information for anti-DAAM1 antibody

Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton. Recent evidence suggests a role for the Formin homology (FH) proteins in these processes. DAAM1 contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by DAAM1, which is thought to function as a scaffolding protein.

Product Categories/Family for anti-DAAM1 antibody

Antibodies; Actin Related Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21071077
• NCBI GeneID: 23002
• NCBI Accession #: NP_055807
• NCBI GenBank Nucleotide #: NM_014992
• UniProt Accession #: Q9Y4D1
• Molecular Weight: 123kDa
• NCBI Official Full Name: disheveled-associated activator of morphogenesis 1 isoform 1
• NCBI Official Synonym Full Names: dishevelled associated activator of morphogenesis 1
• NCBI Official Symbol: DAAM1
• NCBI Protein Information: disheveled-associated activator of morphogenesis 1
• UniProt Protein Name: Disheveled-associated activator of morphogenesis 1
• Protein Family: Disheveled-associated activator of morphogenesis
• UniProt Gene Name: DAAM1
• UniProt Synonym Gene Names: KIAA0666
• UniProt Entry Name: DAAM1_HUMAN

NCBI Description

Cell motility, adhesion, cytokinesis, and other functions of the cell cortex are mediated by reorganization of the actin cytoskeleton and several formin homology (FH) proteins have been associated with these processes. The protein encoded by this gene contains two FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. A key regulator of cytoskeletal architecture, the small GTPase Rho, is activated during development by Wnt/Fz signaling to control cell polarity and movement. The protein encoded by this gene is thought to function as a scaffolding protein for the Wnt-induced assembly of a disheveled (Dvl)-Rho complex. This protein also promotes the nucleation and elongation of new actin filaments and regulates cell growth through the stabilization of microtubules. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2012]

Uniprot Description

DAAM1: Binds to disheveled (Dvl) and Rho, and mediates Wnt- induced Dvl-Rho complex formation. May play a role as a scaffolding protein to recruit Rho-GDP and Rho-GEF, thereby enhancing Rho-GTP formation. Can direct nucleation and elongation of new actin filaments. Belongs to the formin homology family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 14q23.1

Cellular Component: membrane; cytoplasm; stress fiber; plasma membrane; cytosol

Molecular Function: identical protein binding; protein binding; Rho GTPase binding; actin binding

Biological Process: actin cytoskeleton organization and biogenesis