Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DAAM1 monoclonal antibody (M05), clone 5D3 Western Blot analysis of DAAM1 expression in A-431.)

Mouse DAAM1 Monoclonal Antibody | anti-DAAM1 antibody

DAAM1 (Dishevelled Associated Activator of Morphogenesis 1, FLJ41657, KIAA0666) (Biotin)

Applications
Western Blot
Purity
Purified
Synonyms
DAAM1; Monoclonal Antibody; DAAM1 (Dishevelled Associated Activator of Morphogenesis 1; FLJ41657; KIAA0666) (Biotin); Dishevelled Associated Activator of Morphogenesis 1; KIAA0666; anti-DAAM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5D3
Specificity
Recognizes DAAM1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DAAM1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DAAM1 (NP_055807, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DAAM1 monoclonal antibody (M05), clone 5D3 Western Blot analysis of DAAM1 expression in A-431.)

Western Blot (WB) (DAAM1 monoclonal antibody (M05), clone 5D3 Western Blot analysis of DAAM1 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody (M05), clone 5D3.Lane 1: DAAM1 transfected lysate(122 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody (M05), clone 5D3.Lane 1: DAAM1 transfected lysate(122 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged DAAM1 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DAAM1 is approximately 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(DAAM1 monoclonal antibody (M05), clone 5D3. Western Blot analysis of DAAM1 expression in PC-12.)

Western Blot (WB) (DAAM1 monoclonal antibody (M05), clone 5D3. Western Blot analysis of DAAM1 expression in PC-12.)
Related Product Information for anti-DAAM1 antibody
Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. [provided by RefSeq]
Product Categories/Family for anti-DAAM1 antibody
References
1. Molecular profile of endothelial invasion of three-dimensional collagen matrices: insights into angiogenic sprout induction in wound healing.Su SC, Mendoza EA, Kwak HI, Bayless KJ.Am J Physiol Cell Physiol. 2008 Nov;295(5):C1215-29. Epub 2008 Sep 11. 2.Daam1 regulates the endocytosis of EphB during the convergent extension of the zebrafish notochord.Kida YS, Sato T, Miyasaka KY, Suto A, Ogura T.Proc Natl Acad Sci U S A. 2007 Apr 17;104(16):6708-13. Epub 2007 Apr 5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
123kDa
NCBI Official Full Name
disheveled-associated activator of morphogenesis 1 isoform 1
NCBI Official Synonym Full Names
dishevelled associated activator of morphogenesis 1
NCBI Official Symbol
DAAM1
NCBI Protein Information
disheveled-associated activator of morphogenesis 1
UniProt Protein Name
Disheveled-associated activator of morphogenesis 1
UniProt Gene Name
DAAM1
UniProt Synonym Gene Names
KIAA0666
UniProt Entry Name
DAAM1_HUMAN

NCBI Description

Cell motility, adhesion, cytokinesis, and other functions of the cell cortex are mediated by reorganization of the actin cytoskeleton and several formin homology (FH) proteins have been associated with these processes. The protein encoded by this gene contains two FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. A key regulator of cytoskeletal architecture, the small GTPase Rho, is activated during development by Wnt/Fz signaling to control cell polarity and movement. The protein encoded by this gene is thought to function as a scaffolding protein for the Wnt-induced assembly of a disheveled (Dvl)-Rho complex. This protein also promotes the nucleation and elongation of new actin filaments and regulates cell growth through the stabilization of microtubules. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2012]

Uniprot Description

DAAM1: Binds to disheveled (Dvl) and Rho, and mediates Wnt- induced Dvl-Rho complex formation. May play a role as a scaffolding protein to recruit Rho-GDP and Rho-GEF, thereby enhancing Rho-GTP formation. Can direct nucleation and elongation of new actin filaments. Belongs to the formin homology family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 14q23.1

Cellular Component: membrane; cytoplasm; stress fiber; plasma membrane; cytosol

Molecular Function: identical protein binding; protein binding; Rho GTPase binding; actin binding

Biological Process: actin cytoskeleton organization and biogenesis

Research Articles on DAAM1

Similar Products

Product Notes

The DAAM1 daam1 (Catalog #AAA6170700) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DAAM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DAAM1 daam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DAAM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.