Mouse anti-Human CYTH1 Monoclonal Antibody | anti-Cyth1 antibody

CYTH1 (Cytohesin-1, PH, SEC7 and Coiled-coil Domain-containing Protein 1, SEC7 Homolog B2-1, D17S811E, PSCD1)

Cat. Num. AAA6013248

• Gene Names: Cyth1; Sec7; Pscd1
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CYTH1; Monoclonal Antibody; CYTH1 (Cytohesin-1; PH; SEC7 and Coiled-coil Domain-containing Protein 1; SEC7 Homolog B2-1; D17S811E; PSCD1); Anti -CYTH1 (Cytohesin-1; anti-Cyth1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D6
• Specificity: Recognizes human PSCD1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH

• Applicable Applications for anti-Cyth1 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Full length recombinant corresponding to aa1-398 from PSCD1 (AAH50452) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (69.52kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PSCD1 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(immunofluorescence of monoclonal antibody to PSCD1 on HeLa cell . [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PSCD1 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-Cyth1 antibody

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This gene is highly expressed in natural killer and peripheral T cells, and regulates the adhesiveness of integrins at the plasma membrane of lymphocytes. The encoded protein is 83% homologous to that of CYTH2.

Product Categories/Family for anti-Cyth1 antibody

Antibodies; Abs to Pleckstrin Homology Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 183986521
• NCBI GeneID: 116691
• UniProt Accession #: P97694
• Molecular Weight: 46,274 Da
• NCBI Official Full Name: Cyth1 protein
• NCBI Official Synonym Full Names: cytohesin 1
• NCBI Official Symbol: Cyth1
• NCBI Official Synonym Symbols: Sec7; Pscd1
• NCBI Protein Information: cytohesin-1; rSec7-1; SEC7 homolog A; pleckstrin homology, Sec7 and coiled-coil domains 1; PH, SEC7 and coiled-coil domain-containing protein 1; pleckstrin homology, Sec7 and coiled/coil domains 1(cytohesin 1)
• UniProt Protein Name: Cytohesin-1
• Protein Family: Cytohesin
• UniProt Gene Name: Cyth1
• UniProt Synonym Gene Names: Pscd1; Sec7a; rSec7-1
• UniProt Entry Name: CYH1_RAT

NCBI Description

may play a role in transport from the Golgi apparatus to secretory vesicles [RGD, Feb 2006]

Uniprot Description

cytohesin 1: Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF through replacement of GDP with GTP. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs, ARF; Motility/polarity/chemotaxis; GEFs

Cellular Component: extrinsic to internal side of plasma membrane; tight junction; cytoplasm; plasma membrane; trans-Golgi network; cytosol

Molecular Function: lipid binding; ARF guanyl-nucleotide exchange factor activity

Biological Process: vesicle-mediated transport; regulation of cell adhesion; regulation of ARF protein signal transduction; positive regulation of GTPase activity