Mouse anti-Human CTSD Monoclonal Antibody | anti-CTSD antibody

CTSD (Cathepsin D, CPSD) (FITC)

Cat. Num. AAA6146712

• Gene Names: CTSD; CPSD; CLN10; HEL-S-130P
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CTSD; Monoclonal Antibody; CTSD (Cathepsin D; CPSD) (FITC); anti-CTSD antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3F12-1B9
• Specificity: Recognizes human CTSD.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-CTSD antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 1.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa26-412 from human CTSD (AAH16320) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (71.06kD).)

Western Blot (WB)

(Western Blot analysis of CTSD expression in transfected 293T cell line by CTSD monoclonal antibody. Lane 1: CTSD transfected lysate (44.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CTSD on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of CTSD transfected lysate using CTSD monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CTSD rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CTSD is ~3ng/ml as a capture antibody.)

Product Categories/Family for anti-CTSD antibody

Antibodies; Cathepsin

References

1. Characterization of the Human Gastric Fluid Proteome Reveals Distinct pH-Dependent Protein Profiles: Implications for Biomarker Studies. Kam SY, Hennessy T, Chua SC, Gan CS, Philp R, Hon KK, Lai L, Chan WH, Ong HS, Wong WK, Lim KH, Ling KL, Tan HS, Tan MM, Ho M, Kon OL.J Proteome Res. 2011 Aug 15.

NCBI and Uniprot Product Information

• NCBI GI #: 37588930
• NCBI GeneID: 1509
• Molecular Weight: 44,552 Da
• NCBI Official Full Name: Homo sapiens cathepsin D, mRNA
• NCBI Official Synonym Full Names: cathepsin D
• NCBI Official Symbol: CTSD
• NCBI Official Synonym Symbols: CPSD; CLN10; HEL-S-130P
• NCBI Protein Information: cathepsin D
• Protein Family: Cathepsin

NCBI Description

This gene encodes a member of the A1 family of peptidases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the cathepsin D light and heavy chains, which heterodimerize to form the mature enzyme. This enzyme exhibits pepsin-like activity and plays a role in protein turnover and in the proteolytic activation of hormones and growth factors. Mutations in this gene play a causal role in neuronal ceroid lipofuscinosis-10 and may be involved in the pathogenesis of several other diseases, including breast cancer and possibly Alzheimer's disease. [provided by RefSeq, Nov 2015]