Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human PRDX4 Monoclonal Antibody | anti-PRDX4 antibody

PRDX4 (Peroxiredoxin-4, Antioxidant Enzyme AOE372, AOE37-2, Peroxiredoxin IV, Prx-IV, Thioredoxin Peroxidase AO372, Thioredoxin-dependent Peroxide Reductase A0372) (HRP)

Gene Names
PRDX4; PRX-4; AOE372; AOE37-2; HEL-S-97n
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRDX4; Monoclonal Antibody; PRDX4 (Peroxiredoxin-4; Antioxidant Enzyme AOE372; AOE37-2; Peroxiredoxin IV; Prx-IV; Thioredoxin Peroxidase AO372; Thioredoxin-dependent Peroxide Reductase A0372) (HRP); anti-PRDX4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
2C12
Specificity
Recognizes human PRDX4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PRDX4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa51-150 from PRDX4 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CHFFAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSV
Conjugate
HRP
Preparation and Storage
May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(PRDX4 monoclonal antibody Western Blot analysis of PRDX4 expression in human liver.)

Western Blot (WB) (PRDX4 monoclonal antibody Western Blot analysis of PRDX4 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of PRDX4 expression in transfected 293T cell line by PRDX4 monoclonal antibody. Lane 1: PRDX4 transfected lysate (30.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRDX4 expression in transfected 293T cell line by PRDX4 monoclonal antibody. Lane 1: PRDX4 transfected lysate (30.5kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PRDX4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PRDX4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])
Product Categories/Family for anti-PRDX4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30,540 Da
NCBI Official Full Name
Homo sapiens peroxiredoxin 4, mRNA
NCBI Official Synonym Full Names
peroxiredoxin 4
NCBI Official Symbol
PRDX4
NCBI Official Synonym Symbols
PRX-4; AOE372; AOE37-2; HEL-S-97n
NCBI Protein Information
peroxiredoxin-4; antioxidant enzyme AOE372; epididymis secretory sperm binding protein Li 97n; peroxiredoxin IV; prx-IV; thioredoxin peroxidase (antioxidant enzyme); thioredoxin peroxidase AO372; thioredoxin-dependent peroxide reductase A0372
Protein Family

NCBI Description

The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. [provided by RefSeq, Jul 2008]

Research Articles on PRDX4

Similar Products

Product Notes

The PRDX4 (Catalog #AAA6154327) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRDX4 (Peroxiredoxin-4, Antioxidant Enzyme AOE372, AOE37-2, Peroxiredoxin IV, Prx-IV, Thioredoxin Peroxidase AO372, Thioredoxin-dependent Peroxide Reductase A0372) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRDX4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRDX4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRDX4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.